KEGG   Filifactor alocis: HMPREF0389_00386Help
Entry
HMPREF0389_00386  CDS       T01663                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
faa  Filifactor alocis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0389_00386
   01230 Biosynthesis of amino acids
    HMPREF0389_00386
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0389_00386
   00030 Pentose phosphate pathway
    HMPREF0389_00386
   00051 Fructose and mannose metabolism
    HMPREF0389_00386
   00052 Galactose metabolism
    HMPREF0389_00386
  Energy metabolism
   00680 Methane metabolism
    HMPREF0389_00386
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HMPREF0389_00386
Enzymes [BR:faa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF0389_00386
Protein phosphatases and associated proteins [BR:faa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HMPREF0389_00386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(287196..288158)
Genome map
AA seq 320 aa AA seqDB search
MRRIAVLTSGGDAPGMNAAVRAVVRTAVYNNVEVYGVQRGFKGLIEGDFIKLNVSFVGDI
IHRGGTVLRSARCLEFQNQESCRKCAVDLLNVFQIDGLIVIGGDGSFRGMTSLTEYGFST
IGIPGTIDNDLAYTDFTIGFDTAVNTVVEAMSKLRDTTSSHERITIVEVMGRRCGDIALY
AGLSGGAEAILIPEVQYDLSQIAEQLIKSNNRGKKQSIIVVAEGVGNTEFISKEINHLTG
FDTMTTILGHVQRGGNPSSRDRLLGSMMGNRAVDLLLNNITNRVVGVKDNQIMDMDINDA
LRSKKRFNREMYNLSKVLSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggattgcagttttaacaagtggtggagatgctcccggaatgaatgccgctgtt
cgcgcggtagttagaacagccgtttataataatgtagaagtatatggagttcaaagaggg
ttcaaaggtctaatagaaggagattttataaaattaaatgtatcttttgtaggagatatt
atccatagaggaggcactgtgttgcgctctgcacgatgcttggaattccagaatcaagaa
tcgtgcagaaaatgtgcagtcgatttgttaaatgtatttcagatagatggactgattgta
ataggtggagatggtagttttagaggtatgacttctttgacagaatatggattttcaaca
ataggaattccaggaaccattgataatgacttggcatatacagattttacaattggattt
gatacggcagtaaacacagttgttgaagctatgagcaaattacgtgatacaacatcttcg
catgaaagaataactattgttgaagtaatgggtagaagatgtggtgatatcgcattgtat
gcaggtttatccggaggtgcggaggcaattttaattccggaggtacaatacgatttgagt
caaattgcagaacaattaataaaaagcaacaatcgaggaaaaaaacagagtattattgtt
gtagcagagggagttgggaacacagagtttatatcaaaagaaatcaatcatttgacaggg
tttgataccatgacgacaatattaggacatgttcaacgtggtgggaatccttcctccaga
gatagactcttaggaagtatgatgggaaatagagcagttgatcttctgttgaataatatc
acaaatagagtggttggagtaaaagataatcagattatggatatggatataaacgatgct
cttcgttcaaaaaagagatttaacagagagatgtacaacttgtcaaaagtattgtccatt
taa

DBGET integrated database retrieval system