KEGG   Filifactor alocis: HMPREF0389_00461Help
Entry
HMPREF0389_00461  CDS       T01663                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
faa  Filifactor alocis
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0389_00461
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HMPREF0389_00461
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    HMPREF0389_00461
Enzymes [BR:faa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HMPREF0389_00461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
203119..204237
Genome map
AA seq 372 aa AA seqDB search
MSKKAKRVVVKLGSSSLTYENGKLNLIQIEQLVRQIADLKNQGHDVLVVSSGAISAGMGY
LNYSKRPKTLPEKQACAAIGQGKLLHLYEKLFCEYGYSVGQILLTKEDFADRERFLNSRS
VLNELLSKNIIPIINENDAVVVSEIKFGDNDTLSALVSTLIEADLLIILSDIDGLFDKNP
QVHKDAKLIEYVEKIDSKIESLAGDSISNVGTGGMRTKINAAKIATRSGVSVIIAKSNKQ
NVLNCILNGQKIGTFFVEEPHQLKLRKSWIAYNARGKGQIVIDLGAYQAIENNKSLLPSG
IIEVRGEFRKGDVVDILFENKIIGRGLTYFDYDALNKIKGKHSEEIEDIIGTKDYDEVIH
KDNLVRKEITIE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaggctaaaagagtagttgttaaactgggctcttccagtttaacttatgag
aacggaaagttaaatttaatacaaattgaacaattagtaagacaaattgcagatttaaaa
aatcaaggacacgatgttcttgttgtaagttccggagcgatttctgccggtatgggttat
ttgaattattctaagagaccaaaaactttacccgaaaaacaggcatgcgctgcaattggg
caggggaaattattgcatttgtatgaaaaactgttttgtgaatatggatattcagtgggg
caaattttgttaacaaaagaagattttgctgatagagaaagatttttgaattccagaagt
gtactaaatgaattgttatcaaaaaatattattcctattatcaacgaaaatgacgcagtt
gttgtttctgaaataaagtttggtgacaatgatacactgtctgctttagtcagtacctta
atagaagctgatttattgattatactttcagatatagatggtttgtttgataagaaccct
caagttcataaagacgcaaagttgatagaatatgtagaaaaaatagattctaagattgag
agccttgcaggagacagtatttctaatgtaggaaccggaggtatgcgaacaaaaattaat
gcagctaaaatagctactcgatcaggtgtctctgtaattattgcaaaaagtaataaacaa
aatgtgttaaattgtatcttaaacggacaaaaaatagggaccttttttgttgaggaacct
catcaactaaaacttagaaaaagctggatagcatataacgcaagaggaaaagggcaaatt
gttattgaccttggtgcatatcaagctatagaaaataataaaagtttgttaccttccgga
ataatagaggttcggggagaatttagaaaaggggatgttgtggacattctttttgaaaat
aaaataatcggaagagggcttacttattttgattatgatgctctcaataaaattaaagga
aaacattctgaagaaattgaagacattatcgggacgaaggattatgatgaggtgattcat
aaagataatttggtcaggaaggagattacgattgaataa

DBGET integrated database retrieval system