KEGG   Filifactor alocis: HMPREF0389_00461Help
Entry
HMPREF0389_00461  CDS       T01663                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
faa  Filifactor alocis
Pathway
faa00330  Arginine and proline metabolism
faa00332  Carbapenem biosynthesis
faa01100  Metabolic pathways
faa01130  Biosynthesis of antibiotics
faa01230  Biosynthesis of amino acids
Module
faa_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HMPREF0389_00461 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    HMPREF0389_00461 (proB)
Enzymes [BR:faa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HMPREF0389_00461 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: EFE28545
UniProt: D6GSA4
Position
203119..204237
Genome map
AA seq 372 aa AA seqDB search
MSKKAKRVVVKLGSSSLTYENGKLNLIQIEQLVRQIADLKNQGHDVLVVSSGAISAGMGY
LNYSKRPKTLPEKQACAAIGQGKLLHLYEKLFCEYGYSVGQILLTKEDFADRERFLNSRS
VLNELLSKNIIPIINENDAVVVSEIKFGDNDTLSALVSTLIEADLLIILSDIDGLFDKNP
QVHKDAKLIEYVEKIDSKIESLAGDSISNVGTGGMRTKINAAKIATRSGVSVIIAKSNKQ
NVLNCILNGQKIGTFFVEEPHQLKLRKSWIAYNARGKGQIVIDLGAYQAIENNKSLLPSG
IIEVRGEFRKGDVVDILFENKIIGRGLTYFDYDALNKIKGKHSEEIEDIIGTKDYDEVIH
KDNLVRKEITIE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaggctaaaagagtagttgttaaactgggctcttccagtttaacttatgag
aacggaaagttaaatttaatacaaattgaacaattagtaagacaaattgcagatttaaaa
aatcaaggacacgatgttcttgttgtaagttccggagcgatttctgccggtatgggttat
ttgaattattctaagagaccaaaaactttacccgaaaaacaggcatgcgctgcaattggg
caggggaaattattgcatttgtatgaaaaactgttttgtgaatatggatattcagtgggg
caaattttgttaacaaaagaagattttgctgatagagaaagatttttgaattccagaagt
gtactaaatgaattgttatcaaaaaatattattcctattatcaacgaaaatgacgcagtt
gttgtttctgaaataaagtttggtgacaatgatacactgtctgctttagtcagtacctta
atagaagctgatttattgattatactttcagatatagatggtttgtttgataagaaccct
caagttcataaagacgcaaagttgatagaatatgtagaaaaaatagattctaagattgag
agccttgcaggagacagtatttctaatgtaggaaccggaggtatgcgaacaaaaattaat
gcagctaaaatagctactcgatcaggtgtctctgtaattattgcaaaaagtaataaacaa
aatgtgttaaattgtatcttaaacggacaaaaaatagggaccttttttgttgaggaacct
catcaactaaaacttagaaaaagctggatagcatataacgcaagaggaaaagggcaaatt
gttattgaccttggtgcatatcaagctatagaaaataataaaagtttgttaccttccgga
ataatagaggttcggggagaatttagaaaaggggatgttgtggacattctttttgaaaat
aaaataatcggaagagggcttacttattttgattatgatgctctcaataaaattaaagga
aaacattctgaagaaattgaagacattatcgggacgaaggattatgatgaggtgattcat
aaagataatttggtcaggaaggagattacgattgaataa

DBGET integrated database retrieval system