KEGG   Filifactor alocis: HMPREF0389_00533Help
Entry
HMPREF0389_00533  CDS       T01663                                 

Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
faa  Filifactor alocis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF0389_00533
Enzymes [BR:faa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HMPREF0389_00533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
119654..120529
Genome map
AA seq 291 aa AA seqDB search
MKQLSLDVCGKINLSLDVTGKRDDGYHFVSMIMQTVSLKDSLCIKKREDDFFFLNIGNSS
IPSGEDNIIYKAVSLYHQMTRTGLGYEITLDKKIPVEAGMAGGSADAAGVLYALNEMNHC
KLSREELLKLSVRLGADVPYMLLGGTYLATGIGEHLQKLPDVSYHILVVKPNKGVSTKSV
YQNLDINHLKNRPNNDKMIECIHSKKYDEIYPFMGNVLYESAKKFVPEMERIIFDMESKF
SCSKAMMTGSGSTVYGIFENLEDRSRANKYFLEHYTEVYEVETTNYSISIR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacagttgagtctcgatgtttgtgggaaaataaatctttcgttggatgtgacggga
aaaagagacgacggataccattttgtatctatgattatgcaaacggtcagtttaaaagat
tcgttatgtattaagaagagagaagatgatttcttttttttaaatataggaaattcgtct
attccatccggagaagataatatcatttataaggctgtttcattgtaccatcaaatgaca
cggacaggattgggatatgagattacattggacaagaagattcccgttgaagcaggaatg
gcgggcggaagcgcggatgctgcaggggttttatatgcacttaatgaaatgaatcattgc
aaattatctcgtgaagaattactgaaactttctgtgcgattgggtgcggatgttccatat
atgttgcttggaggaacttatttggcaaccggaatcggagaacatcttcaaaaactgcct
gatgtatcttatcatatactggttgtgaaaccgaataaaggagtcagtacgaagtcagtt
taccaaaatttagacataaatcacttaaaaaacagaccgaataatgataaaatgatagaa
tgtattcattctaagaaatatgatgaaatctatccgtttatgggaaatgttttgtatgaa
tctgccaaaaagtttgtacctgagatggaacggattatttttgatatggaatctaagttt
tcatgttccaaagcgatgatgaccgggagcggttccactgtttatgggatatttgaaaat
ttggaagatagaagcagggcgaataaatattttttagaacattacactgaagtatatgag
gtagaaacaacaaattattccatctctattagatag

DBGET integrated database retrieval system