KEGG   Filifactor alocis: HMPREF0389_00565Help
Entry
HMPREF0389_00565  CDS       T01663                                 

Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
faa  Filifactor alocis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0389_00565
   01230 Biosynthesis of amino acids
    HMPREF0389_00565
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0389_00565
   00051 Fructose and mannose metabolism
    HMPREF0389_00565
   00562 Inositol phosphate metabolism
    HMPREF0389_00565
Enzymes [BR:faa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0389_00565
Exosome [BR:faa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF0389_00565
  Exosomal proteins of bladder cancer cells
   HMPREF0389_00565
  Exosomal proteins of melanoma cells
   HMPREF0389_00565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1172335..1173084)
Genome map
AA seq 249 aa AA seqDB search
MRKVIIAGNWKMNKTVSESVEFIEELKKEELDKEVECVVCAPFISLERLSIASKNTAIKL
GAQNVSQYDNGAYTGEISTSMLKDLNMEYVILGHSERRQYFLETNEVINQKVQKVLSSKM
TPILCVGETLEERESRKMNDVIATQIKEGLANLSFEQAKGVVVAYEPIWAIGTGKTATSD
QANEMAMFIRKQLRKLFQDVAEDISILYGGSVKPNNIKEIMVQSDIDGALVGGAALKVDS
FAELVNYHK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagtgattattgcaggaaactggaagatgaataagacggtttccgaatcggta
gaatttatagaagaactaaaaaaagaagagttggataaagaagtagagtgtgtggtttgt
gcaccgttcatttcgttggaaagattgagtattgcttctaagaacactgcaattaaatta
ggcgctcaaaatgtgtcacagtatgataacggtgcttataccggtgaaatctcaacatct
atgttgaaagacttgaatatggagtatgttatccttggacactctgaaagaagacagtat
tttttagagacgaatgaagttatcaatcaaaaggtacaaaaggtattatcttctaagatg
actccgattttatgtgtcggagaaacattggaagagagagaatctagaaagatgaatgat
gtgattgcaacacagataaaagaaggattagccaatctttctttcgaacaagcaaaaggt
gttgtcgtagcttatgaaccgatatgggctatcggaacaggaaaaaccgctacgagcgat
caagcaaacgaaatggcaatgtttattcgaaaacaactgagaaaattgttccaagatgtg
gcagaggatatttctattttatatggaggttctgtcaaaccgaacaatatcaaagagatt
atggtacaatcagatatcgatggtgctttggtaggtggagctgcattaaaggtagattct
tttgcagagttggtaaactatcataagtaa

DBGET integrated database retrieval system