KEGG   Filifactor alocis: HMPREF0389_00565Help
Entry
HMPREF0389_00565  CDS       T01663                                 

Definition
(RefSeq) triose-phosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
faa  Filifactor alocis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0389_00565
   01230 Biosynthesis of amino acids
    HMPREF0389_00565
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0389_00565
   00051 Fructose and mannose metabolism
    HMPREF0389_00565
   00562 Inositol phosphate metabolism
    HMPREF0389_00565
Enzymes [BR:faa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0389_00565
Exosome [BR:faa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF0389_00565
  Exosomal proteins of bladder cancer cells
   HMPREF0389_00565
  Exosomal proteins of melanoma cells
   HMPREF0389_00565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1172335..1173084)
Genome map
AA seq 249 aa AA seqDB search
MRKVIIAGNWKMNKTVSESVEFIEELKKEELDKEVECVVCAPFISLERLSIASKNTAIKL
GAQNVSQYDNGAYTGEISTSMLKDLNMEYVILGHSERRQYFLETNEVINQKVQKVLSSKM
TPILCVGETLEERESRKMNDVIATQIKEGLANLSFEQAKGVVVAYEPIWAIGTGKTATSD
QANEMAMFIRKQLRKLFQDVAEDISILYGGSVKPNNIKEIMVQSDIDGALVGGAALKVDS
FAELVNYHK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagtgattattgcaggaaactggaagatgaataagacggtttccgaatcggta
gaatttatagaagaactaaaaaaagaagagttggataaagaagtagagtgtgtggtttgt
gcaccgttcatttcgttggaaagattgagtattgcttctaagaacactgcaattaaatta
ggcgctcaaaatgtgtcacagtatgataacggtgcttataccggtgaaatctcaacatct
atgttgaaagacttgaatatggagtatgttatccttggacactctgaaagaagacagtat
tttttagagacgaatgaagttatcaatcaaaaggtacaaaaggtattatcttctaagatg
actccgattttatgtgtcggagaaacattggaagagagagaatctagaaagatgaatgat
gtgattgcaacacagataaaagaaggattagccaatctttctttcgaacaagcaaaaggt
gttgtcgtagcttatgaaccgatatgggctatcggaacaggaaaaaccgctacgagcgat
caagcaaacgaaatggcaatgtttattcgaaaacaactgagaaaattgttccaagatgtg
gcagaggatatttctattttatatggaggttctgtcaaaccgaacaatatcaaagagatt
atggtacaatcagatatcgatggtgctttggtaggtggagctgcattaaaggtagattct
tttgcagagttggtaaactatcataagtaa

DBGET integrated database retrieval system