KEGG   Filifactor alocis: HMPREF0389_00568Help
Entry
HMPREF0389_00568  CDS       T01663                                 

Gene name
glsA
Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
faa  Filifactor alocis
Pathway
faa00220  Arginine biosynthesis
faa00250  Alanine, aspartate and glutamate metabolism
faa00471  D-Glutamine and D-glutamate metabolism
faa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0389_00568 (glsA)
   00220 Arginine biosynthesis
    HMPREF0389_00568 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    HMPREF0389_00568 (glsA)
Enzymes [BR:faa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     HMPREF0389_00568 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: EFE28651
UniProt: D6GSL0
Position
complement(1175943..1176872)
Genome map
AA seq 309 aa AA seqDB search
MFDKMTVEEISQRLEQVIQKSDAMKKEGEVATYLPCLSQIDPDGFATSIATTSGKVVESG
DCDIKFSIQSISKVIDFMIALEDVGAETVFSKINTECTRYPYNSVRAIDDRVANPFINAG
ALTVCSLLKGITVDERFQRVADKIKQLSGADEIRTQKEFHFVTDINRSLVYYLRGVGLID
SNVNVEEVLDLYVRICFIELNATEMAHMAGVLANGGRSLDNRKQIIDEEIVKMGVSLMAT
CGMYESSGKFLMQTGFPAKSGVSGGIMAVVPGKCGICTYSPRLDEEGNSLRGNIILSDLS
KEFKLHMFA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacaaaatgacagtagaagaaatcagtcaaagattggaacaagtgattcaaaaa
tcagatgctatgaaaaaagaaggagaagtagccacctacctaccttgtctttctcaaatt
gatccggatggatttgcgacatctattgcgactacttccggaaaggttgtagagagcgga
gattgtgatattaaattttctattcaaagtatttctaaagtaattgattttatgatagcg
ttagaggatgtcggtgcagaaactgttttttctaaaatcaatacagaatgtacgagatat
ccttataattctgtaagagcaatcgatgatagagtggcaaatccgtttatcaacgcagga
gctttgactgtctgttctttactgaaaggaataacggttgatgaaagatttcagagagtt
gctgataaaataaaacaactgagtggagcggacgagatacgaacacagaaagaatttcat
tttgtgacagatatcaatcgttcattggtatactatttaaggggagtaggcttaatcgat
tcgaatgtaaatgtagaagaagtgttggatttatatgttcgaatttgttttattgagtta
aacgcgacagaaatggcacatatggcgggagtattggcaaatggaggaagaagtttagat
aacaggaaacaaatcatagatgaagaaattgtaaaaatgggagtttccttgatggcgact
tgcgggatgtatgagagcagtggtaaatttttgatgcaaacaggatttcctgcaaaaagt
ggcgtgagtggcggcattatggcagttgttccgggaaaatgcggaatttgcacctattca
cctcgattggatgaagaaggaaatagcttgcgaggaaatattattttgtcagatttatcc
aaagaatttaaattgcacatgtttgcataa

DBGET integrated database retrieval system