KEGG   Filifactor alocis: HMPREF0389_00763Help
Entry
HMPREF0389_00763  CDS       T01663                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
faa  Filifactor alocis
Pathway
faa00260  Glycine, serine and threonine metabolism
faa00750  Vitamin B6 metabolism
faa01100  Metabolic pathways
faa01110  Biosynthesis of secondary metabolites
faa01120  Microbial metabolism in diverse environments
faa01230  Biosynthesis of amino acids
Module
faa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0389_00763 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF0389_00763 (thrC)
Enzymes [BR:faa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF0389_00763 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: EFE28842
UniProt: D6GPY9
Position
complement(1396195..1397247)
Genome map
AA seq 350 aa AA seqDB search
MAWNGLIDAYRNYLPVTEKTPRCTLLEGNTPLIRSENLSKELDLELYFKYDGLNPTGSFK
DRGMVMAVAKAVEEGSKTIMCASTGNTSASAAAYAARCGLDCVVLIPDGNIAMGKLAQAL
IYGAKVIAIDGNFDNALDIVKEITNEYPITLVNSLNPYRIEGQKTGAYEVSDVLGDAPDY
LAIPVGNAGNITAYWKGFKDYYEQKKNKQLPTLLGFQAEGASPIVHNRVFEEPKTVATAI
QIGNPASWTKATAALEESKGRIDSVTDEEILQAQKWLASKEGIFAEPASAASLAGVIKQH
KQGLLEKGARVVCVLTGNGLKDPNAALSQIVNPQKIRAEKQAVLDVIYGK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcttggaacggattgattgatgcatatagaaattatttaccggtaacggaaaagaca
cctcgttgtactttgcttgaggggaatacaccgctgattcgaagtgagaatttgtcaaaa
gagttggacttggaactatattttaagtatgacggattgaatccgaccggctcttttaag
gacagaggaatggtaatggctgttgcgaaggcagtggaagaaggctcaaagacgattatg
tgtgcttctaccggaaatacttcggcatctgcggctgcctatgctgcacgatgtggattg
gactgtgttgtattgattccggacggtaatatcgcaatgggaaaattagcacaagcattg
atttatggagcaaaggtaattgcaatagacggaaattttgacaatgcgttggatattgta
aaagaaattacaaatgaatatccgattactttggtaaactcattgaatccttatcgaatc
gaaggacaaaagacaggagcatacgaagtatctgacgtgttgggagatgcaccggattat
ttggcgattccggttggtaatgcaggaaatatcactgcatattggaagggattcaaagat
tattatgaacaaaagaaaaacaaacagcttcctacattattaggattccaagcagaggga
gcttctccgattgttcataatcgtgtatttgaagagcctaagacagttgcaaccgcaatc
caaattggaaatcctgcaagttggactaaggcgactgccgcattggaagagtcgaaggga
agaattgacagtgtaacagatgaagaaattttgcaagcgcaaaaatggttggcatcgaaa
gaaggaatttttgcggaaccggcttccgcagcatctttggcaggagttatcaagcaacat
aaacaaggtttgcttgaaaaaggagcaagagtggtttgtgtgttgacaggaaacgggctg
aaggatccgaatgccgcgttgtctcaaatcgtgaatccacaaaaaatacgtgcggaaaaa
caagctgtgttagatgtcatttatgggaaatag

DBGET integrated database retrieval system