KEGG   Filifactor alocis: HMPREF0389_00791Help
Entry
HMPREF0389_00791  CDS       T01663                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
faa  Filifactor alocis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HMPREF0389_00791
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0389_00791
Enzymes [BR:faa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     HMPREF0389_00791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1427001..1428077)
Genome map
AA seq 358 aa AA seqDB search
MKHLIGINDFTIEELAELIKVGQDISLHPQNYLDKMRGKVMATLFFEPSTRTKFSFETAM
LRLGGQIIGLSEVKNSSVAKGESLKDTVQTVACYTDLIVMRHPMEGAPQLATEILDVPLI
NAGDGGHQHPTQTLTDLLTIYKEKGRLDNLNIALVGDLKYGRTVHSLVEAITKYDNNTFF
FVSPKELEMPEYVKNGIKGGCFFESRSLEEVLPQVDIVYMTRIQKERFDDLETYERLKNV
YILDEEKMKLAKEDTIIMHPLPRVNEITEGVDKDKRAKYFDQAKNGMYIRMALIMKLIEE
AEKDPSRPTKPEYSTIYTTCPNPKCISNHEYVERVEFHEKTAEDHAYSCEYCDRVITI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatttaatcggaattaacgattttacaattgaagaattggcggaattgattaag
gtaggacaagatatttctttgcatccccaaaattatttggataagatgagaggaaaagtc
atggctaccttattttttgagccttctaccagaacaaagttcagttttgagacagcaatg
cttcgtttgggaggacaaattatcggattgtccgaagtaaaaaattcttccgtagcaaaa
ggagaatctttgaaagacaccgttcaaaccgtagcttgttatacagatttaatcgtaatg
agacatccgatggaaggagcaccgcaacttgcgaccgaaattcttgatgttcctttgatt
aacgcgggagacggcgggcatcaacatccgacacaaacattgacagacttgcttaccatc
tataaagaaaaaggtcgtttggataatttgaacatcgcattggtaggagatttgaagtat
ggaagaacagtacattctcttgttgaagcaatcactaaatatgataacaatacattcttt
tttgtatcaccgaaagagttggaaatgccggaatatgtaaagaacggtatcaaaggcgga
tgtttcttcgagagcagaagtttggaagaagttcttccgcaggtagatattgtgtatatg
acaagaatccaaaaagaaagattcgatgatttggaaacatacgaacgtttaaaaaatgta
tatattttagatgaagagaaaatgaagttggcaaaagaagatacgattattatgcatccg
cttccaagggtaaacgagattactgaaggtgtggataaagataagcgtgcaaaatacttt
gaccaagcaaaaaacggaatgtatatcagaatggcattgattatgaaattgattgaagag
gctgaaaaagatccgtcacgcccaaccaaaccggagtattccacgatatatactacttgc
ccgaatccaaaatgcatctcgaatcatgagtatgtagagagagtggaattccatgaaaaa
acagcagaagatcatgcatacagttgtgagtactgtgatagagtaattacaatttaa

DBGET integrated database retrieval system