KEGG   Filifactor alocis: HMPREF0389_00923Help
Entry
HMPREF0389_00923  CDS       T01663                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
faa  Filifactor alocis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF0389_00923
Enzymes [BR:faa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     HMPREF0389_00923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1553087..1554238
Genome map
AA seq 383 aa AA seqDB search
MKKIALFGSTGSIGTQTTSVVDEFSDRLELCILSAHSNTTLLLEQIKKYHPQFVFVTNQQ
SFELIQKECEHISVVVLYGWDSLSDVLSSCKIDIAIGAISGFAGILPTLICIEHNLTIGL
ANKETLVAGGDLVKKALQQHPTARIIPVDSEHSAIFQCLEENQIIDKILLTASGGPFHTF
TGEQLKHIKPKDALKHPNWSMGQKITIDSATLMNKGLEVIEAQRLFQVDYDDIQVLVHPQ
SIVHSMVQYQDGSILAQLGQADMRIPIQYSIFYPKRMKNSFTPFDFGEFLSVTFQKPNTE
LFPALPLAFEAGRIGKSMPCVLNAANEIAVHAFLKEQIEFLDIVAIVKEMMNQFPITEIT
SLEELFELDTKVRSHTTNYINRR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgctctattcggaagtaccggctcaatcggtactcaaacgacttccgtt
gtagatgaattttctgaccgactggaactttgtattttgtcagcacattccaatacaact
ctattacttgagcaaatcaaaaaatatcatccgcaatttgtttttgttacaaatcaacaa
agttttgaattgatacaaaaagagtgtgaacatatctctgttgtagtgttgtacggctgg
gacagtctttccgatgtgctgtcgtcttgcaaaatcgacatcgcaatcggtgcaatcagc
ggatttgccggaattttaccaactttaatctgtatcgagcacaatcttactatcggactt
gccaacaaagaaaccttagttgcaggcggagacttggtaaaaaaagcattgcaacagcat
ccaaccgctcgaatcattccggttgatagtgaacattctgcaatattccaatgtttagaa
gaaaatcaaatcatagataaaatactgttaactgcttccggaggtccctttcataccttt
accggagaacagttaaagcatatcaaaccgaaagatgctctcaaacatccgaattggtcc
atgggacaaaaaattacaatagactctgccactttgatgaacaaaggacttgaagtgatt
gaggcacagagattattccaagtggattatgatgatatccaagttttggtgcatccgcaa
agcatcgtacattctatggtacagtaccaagacggcagcattttagcacagttgggacaa
gcggatatgagaataccgattcaatactccatcttctatccgaaacgaatgaaaaactcc
ttcactccgtttgacttcggagaatttttgagtgtgaccttccaaaaaccgaataccgaa
ctgtttcctgcacttcctcttgcgtttgaagcaggacgaatcggaaagtcgatgccatgt
gtactgaacgcagcaaacgagatagcggttcatgcatttctaaaagaacaaattgaattt
ttggatattgttgcaattgtgaaagaaatgatgaatcaatttccgattactgaaattact
tcattggaagaactgtttgaattggataccaaagtgcgttctcataccacgaactatatc
aacagaaggtga

DBGET integrated database retrieval system