KEGG   Filifactor alocis: HMPREF0389_01233Help
Entry
HMPREF0389_01233  CDS       T01663                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
faa  Filifactor alocis
Pathway
faa00480  Glutathione metabolism
faa00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HMPREF0389_01233
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HMPREF0389_01233
Enzymes [BR:faa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HMPREF0389_01233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC
Motif
Other DBs
NCBI-ProteinID: EFE27981
UniProt: D6GSZ6
Position
complement(1884360..1884863)
Genome map
AA seq 167 aa AA seqDB search
MYRYGKKGIMMSIYDFKVKDSNGNIFDMQRCRGKIILIVNTASKCGFTPQFGALEELYRQ
CHMKGLEIIGFPCNQFAAQDPGTNDEIKSFCQLNYGVTFPMMSKIEVNGENEEPLYTFLK
NEKGGLLGKAIKWNFTKFLIDREGNVVKRFAPSVQPKDIKKVIEMML
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgatacggtaagaaaggtattatgatgtcaatttatgattttaaggtaaaggat
tcaaacggaaatatatttgatatgcagcgatgtagaggtaagattattttgattgtaaat
acagcgagcaaatgcggttttacgccacagttcggagcgttggaagagttatatcgtcaa
tgtcatatgaaagggttggaaattatcggatttccttgcaatcaatttgcggcacaggat
cccggaacaaatgatgaaatcaagagcttttgtcagctgaactacggagtgacattcccg
atgatgtcaaagatagaagtgaacggggaaaatgaagagccgctgtacacttttttgaag
aatgaaaagggcggactgttggggaaggcaattaaatggaattttacaaaatttttgatt
gatagagaaggaaatgtggtcaaaaggtttgcgccgagtgtacaaccgaaggatatcaaa
aaggtcattgagatgatgctttaa

DBGET integrated database retrieval system