KEGG   Filifactor alocis: HMPREF0389_01437Help
Entry
HMPREF0389_01437  CDS       T01663                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
faa  Filifactor alocis
Pathway
faa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:faa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF0389_01437 (recR)
DNA repair and recombination proteins [BR:faa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     HMPREF0389_01437 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HMPREF0389_01437 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim Prok-RING_4 HHH zf-RING_9 HHH_5 IMS_HHH Memo
Motif
Other DBs
NCBI-ProteinID: EFE27806
UniProt: D6GTJ9
Position
complement(1005643..1006242)
Genome map
AA seq 199 aa AA seqDB search
MQHYSNHIDQLIERLGKLPGIGYKTAQRLAFYIINMPKDEVIGLANAMQNAKEHITYCEV
CYNISDANPCSICDSKTRDSATICVVEDPRDVAAMERTREYHGKYHVLHGTISPSQAITP
DMIRIKELMSRLHDPEIKEIIIATNTTIDGEATAMYLARLIKPFGIKVTRIAHGLPVGAN
LEFADDVTIGRALEGRREL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcaacactattccaaccatattgaccagttaattgagcgattgggaaaacttcccgga
ataggatacaaaacggcacaaagattggcattttatattattaatatgccgaaagacgaa
gtgattggacttgcgaatgcaatgcagaatgcaaaagaacatattacctattgtgaagtt
tgttataatatttcggatgcaaatccgtgcagtatctgtgattccaaaacaagagacagc
gctacaatctgcgtggtagaagatcccagagatgttgcagcaatggagcgtacgagggag
tatcatggaaaatatcatgtgttacacggaacgatttctccctctcaagcaattactccg
gatatgattcggattaaagaactgatgagtcgattgcatgaccctgaaatcaaggaaatt
atcatcgcaacgaatacgacgattgatggagaggcaacagcgatgtatcttgctcgttta
attaaaccgttcggtatcaaggtaacaagaatcgcacacggtttacctgtcggagcaaat
ttggaatttgcagatgatgtgacgattggacgtgcattggaaggacgaagagaattataa

DBGET integrated database retrieval system