KEGG   Filifactor alocis: HMPREF0389_01487Help
Entry
HMPREF0389_01487  CDS       T01663                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase RuvA (EC:3.6.1.-)
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
faa  Filifactor alocis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:faa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HMPREF0389_01487 (ruvA)
Enzymes [BR:faa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HMPREF0389_01487 (ruvA)
DNA repair and recombination proteins [BR:faa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     HMPREF0389_01487 (ruvA)
    RecFOR pathway proteins
     HMPREF0389_01487 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
940209..940805
Genome map
AA seq 198 aa AA seqDB search
MIGLLYGEIEELSLDSILLVCSGVGYEIQVSQNTMEHCKQHSNIRLYTKMIVREDNISLI
GFFEKSEKELFEQLTSVSKIGPKVGLSILSTYQVDQIKSYIVTANIEKLSKVSGVGKKTA
ERIVLELKDKISHFEIDNDAIEIASPINQTEDDAIEALVSLGFSKNESYDAVQEVKQQYT
AQSLDELIPLALSKLSKV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgataggactattatacggagaaattgaagaactgtccttagacagtattctgcttgtt
tgtagtggagtcggatatgaaattcaagtttctcaaaacacaatggaacattgtaaacaa
cattctaatatccgattgtatacaaaaatgattgttcgggaagataatatttctttgatc
ggattctttgaaaaatcagagaaagaattgtttgaacagttgacttccgtatcaaaaatc
ggtccgaaagtaggattatccattctatcgacttatcaagtagatcaaatcaaatcctat
atcgttactgcaaatattgaaaagctctccaaagtatccggagtaggcaaaaaaacagcc
gaacgaattgtattagaattaaaagataaaatttcacactttgaaattgacaacgatgca
atagaaattgcttcgcccatcaaccaaacagaagatgatgcgatagaagctctcgtaagt
cttggcttttctaaaaacgaatcttatgatgcagtccaagaggtgaaacaacagtataca
gctcaatctctcgatgaattaattcctcttgcactttctaaactgagtaaggtttaa

DBGET integrated database retrieval system