KEGG   Filifactor alocis: HMPREF0389_01487Help
Entry
HMPREF0389_01487  CDS       T01663                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
faa  Filifactor alocis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:faa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
940209..940805
Genome map
AA seq 198 aa AA seqDB search
MIGLLYGEIEELSLDSILLVCSGVGYEIQVSQNTMEHCKQHSNIRLYTKMIVREDNISLI
GFFEKSEKELFEQLTSVSKIGPKVGLSILSTYQVDQIKSYIVTANIEKLSKVSGVGKKTA
ERIVLELKDKISHFEIDNDAIEIASPINQTEDDAIEALVSLGFSKNESYDAVQEVKQQYT
AQSLDELIPLALSKLSKV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgataggactattatacggagaaattgaagaactgtccttagacagtattctgcttgtt
tgtagtggagtcggatatgaaattcaagtttctcaaaacacaatggaacattgtaaacaa
cattctaatatccgattgtatacaaaaatgattgttcgggaagataatatttctttgatc
ggattctttgaaaaatcagagaaagaattgtttgaacagttgacttccgtatcaaaaatc
ggtccgaaagtaggattatccattctatcgacttatcaagtagatcaaatcaaatcctat
atcgttactgcaaatattgaaaagctctccaaagtatccggagtaggcaaaaaaacagcc
gaacgaattgtattagaattaaaagataaaatttcacactttgaaattgacaacgatgca
atagaaattgcttcgcccatcaaccaaacagaagatgatgcgatagaagctctcgtaagt
cttggcttttctaaaaacgaatcttatgatgcagtccaagaggtgaaacaacagtataca
gctcaatctctcgatgaattaattcctcttgcactttctaaactgagtaaggtttaa

DBGET integrated database retrieval system