KEGG   Filifactor alocis: HMPREF0389_01582Help
Entry
HMPREF0389_01582  CDS       T01663                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
faa  Filifactor alocis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:faa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0389_01582
   01230 Biosynthesis of amino acids
    HMPREF0389_01582
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0389_01582
  Energy metabolism
   00680 Methane metabolism
    HMPREF0389_01582
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0389_01582
Enzymes [BR:faa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0389_01582
Exosome [BR:faa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0389_01582
  Exosomal proteins of melanoma cells
   HMPREF0389_01582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
823262..824014
Genome map
AA seq 250 aa AA seqDB search
MSYKLVLVRHGESEWNKLNLFTGWMDVDLSENGHQEAIEAGQLLKEEGFRFDVCYTSYLK
RAIHTANHILQELDEEWIPVHKSWKLNERHYGKLQGLNKAETTEKYGKEKVLEWRRSYDI
RPPYLTEEDEKNPANQVPYKNVNKDELPLAECLKDCVARVIPYYKETVKKDMTDGKQVIV
VAHGNSLRSLVKYLDNVSDEEIVGINIPTGIPLVYELDKDFKPIKHYYLGDPAEVEAKMN
AVKNQANVKK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagttataaattagttttggtaagacacggcgaaagcgaatggaataaattaaatctt
tttaccggttggatggatgtggatttgtccgaaaacggtcaccaagaagcaatcgaggca
ggtcaacttctaaaagaagaaggattccgttttgatgtatgctacacttcctatctgaag
cgtgccattcatacggcaaaccacatattacaagaattagatgaagaatggattcctgtt
cacaaatcttggaaattgaacgagcgtcactacggaaaattgcaaggcttaaataaggca
gaaacaaccgaaaaatatggaaaagaaaaggtgcttgaatggagaagatcctatgacatc
agaccgccttacctcacagaagaagacgaaaaaaatcctgcaaatcaagttccttacaaa
aatgtaaacaaagacgagcttccgttggcagaatgcctgaaagactgcgttgctcgtgtg
attccatactataaagaaacagtcaaaaaagatatgacagacggaaaacaggtaattgtt
gttgcacacggcaactcccttcgttctcttgtaaaatatttggacaatgtatccgatgaa
gaaatcgtaggaatcaatattccgacaggaatccctcttgtgtatgaattggacaaagat
ttcaaaccgatcaaacattactaccttggcgatcctgcagaagtagaagcaaaaatgaac
gctgtcaaaaatcaggcaaatgtcaaaaaataa

DBGET integrated database retrieval system