KEGG   Filifactor alocis: HMPREF0389_01604Help
Entry
HMPREF0389_01604  CDS       T01663                                 

Definition
glutamate--tRNA ligase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
faa  Filifactor alocis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:faa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    HMPREF0389_01604
Enzymes [BR:faa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     HMPREF0389_01604
Amino acid related enzymes [BR:faa01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   HMPREF0389_01604
Transfer RNA biogenesis [BR:faa03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    HMPREF0389_01604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(795836..797323)
Genome map
AA seq 495 aa AA seqDB search
MTRVRFAPSPTGFVHIGSLRTALYNYLYAKKTGGTYVLRVEDTDQSRLVEGAVEGMLKAM
KWAGVVNEEGVVLSEEGKVTQAGDCGPYVQSERLDIYKKYIDQLLESGHAYYCFCSKDRL
DKVREIQRAENKVPRYDGHCKGLTKEEVQAKIDAGEPYVIRLKLPANKDLHFKDIVRGDV
VINTNDMDDQVLMKSDGFPTYHFAVVVDDYLMGITHIIRGEEWLPSTPKHVYLYEAFGWE
QPTYVHLPNILNHDHKKLSKRQGDVAVEDFRKKGYLPEALINYIALLGWSPEDNQEVFSM
DELEQYFSLERVSKSGGVFDVAKLNWFNNQYIRERDINELVDLSIPFLVEQDLMTEEEAN
SKKEWLALAMETVRESMDYLAQFPERIKLFISEEVEVWEGEALEFMNLPHMPKLLEVLEQ
KIGEQEEITPDFVSDMFKEIKKEEGIKGKELFMGTRVILTGQNHGPEIPKVLTLLGKDKL
MVRLNQAKEYVLNEE
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacacgagtacgatttgcaccatctcctacagggtttgtgcatataggaagtttgaga
acagcgttgtataattatttgtacgcaaagaaaacaggcggtacctatgttttgagagta
gaggataccgatcaaagcagattggtggaaggcgctgtagaaggaatgctcaaagcgatg
aagtgggcaggtgttgtcaatgaagaaggagttgttctttcagaagaaggtaaagtaaca
caagcaggagattgcggaccttatgtgcaatcggaacgacttgatatctacaaaaaatac
attgaccaactattggaaagcggacacgcatactattgtttctgttccaaagatcgtttg
gataaagtaagagaaattcaacgagcagaaaacaaagtgccgagatatgacggacattgc
aaaggattgacaaaagaagaggtacaggcaaaaatcgatgctggtgaaccatatgtgatt
cgtttgaaattgccggcaaacaaagaccttcatttcaaagatattgtgcgtggagatgtg
gtaatcaatacgaacgatatggatgatcaagtgttgatgaagtcagacggattccctact
tatcactttgctgtcgtagtagacgactatttgatgggaattacacatattattcgtgga
gaagaatggttaccgtccacgccgaaacatgtatatttatatgaagcgttcggatgggaa
caaccgacttatgttcatcttcctaatattttgaatcacgaccataaaaagctgtctaaa
cgacaaggagatgttgcagtagaagactttagaaaaaaaggatatttacctgaggcattg
atcaactacattgcattgttgggctggtcacctgaagataatcaagaagtgttctctatg
gatgaattggaacagtatttcagtttggagagagtttcaaaaagcggtggagttttcgat
gttgcgaaactgaactggttcaacaatcagtacattcgtgaaagagatatcaatgaattg
gtagacctttccattcctttcttagtggaacaggatttaatgacagaagaagaggcgaac
tctaaaaaagaatggttggcacttgcaatggaaacggtaagagagtctatggactacttg
gcacaattccctgaaagaatcaagctattcatttctgaagaagttgaagtttgggaaggc
gaggcattggagtttatgaacttaccgcatatgccgaaattattggaagtgttggaacaa
aaaatcggagaacaggaagaaattacaccggattttgtatccgacatgttcaaagaaatc
aaaaaagaagaaggaatcaaaggaaaagagttgtttatgggaacacgtgtcatcttgaca
ggtcaaaaccacggccctgaaattccaaaagtattgacattacttggaaaagataaattg
atggttcgtttgaatcaagcaaaagagtatgttttgaacgaagagtaa

DBGET integrated database retrieval system