KEGG   Filifactor alocis: HMPREF0389_01628Help
Entry
HMPREF0389_01628  CDS       T01663                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
faa  Filifactor alocis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:faa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(768031..770295)
Genome map
AA seq 754 aa AA seqDB search
MVDQGSDKIEGKIDDIIFHNDSNGYTVASLVTDDLEEITITGIFPTIELGDRFELEGEKV
FHPSYGPQFRVTSYVTKEPATKEAILAFLSSGVLDGIGRTMAERIFDKFGLDAIRVLDDT
PEKLLEIEGIGKKKCQKIIESYKDKRDLKVAILHFSGYGLTPAMAMKIYRYYGEKAKEIV
EQNPYCLCRDIKGIGFRKADEIAERMGIAKNDIHRIMEGVVYLLQEAGMQGHVYLPADVV
REQAAKLLGVSTEEVQSGIYELCISSKTILERSADESERLYLPLYRETESNVANLLSQLL
VKEELDVGVEADTLIQEIQDKTGICLADKQKAAVTTALNEKIMIVTGGPGTGKTTVVKFI
LKCFEKQEKKVVLCAPTGRAAKRLTEASNQDAKTIHRLLEVGFSEDDEEMNYYNRDEQNP
LESDVIIVDEMSMVDMFLMRALLRAIPKHARLIMIGDADQLPSVGAGNVLWDMIESNLIP
VVRLTEIFRQEEESQIIQNAHRVNHGQELIIDKESKDFFFMMRRDGDKVKDLILELIKER
LPNYFGVESTEIQILTPVRKGGIGMHEINQKVQETLNPPSEERAEFKYMNTVFRENDKVM
QIKNNYEKKYRNTVTYEEGEGVFNGDIGVIDTVDVRGKQFYITFDDNRRCRYEFAEVDNI
EHAYAITVHKSQGSEFDVVILPILSLPPMLQNRNILYTAITRAKKGLVLVGNMYYVNRMI
QNMDRQERYSSLAERLKFMKEHYFEDEVSKETCP
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atggtggatcaaggatcagataagatagaaggaaaaattgatgatattatttttcataat
gattccaatggatatactgttgcttctcttgtgacggatgatttagaggagattacaatt
acagggatttttccgacgattgagttgggagatcggtttgaactggaaggcgaaaaggtg
ttccatccaagttatggaccgcagtttcgtgtgacaagttatgtgacgaaggagcctgct
actaaggaggctattttggcatttttgagttccggtgttttggacgggattgggagaacg
atggcggagcgtatttttgacaaattcggtttggatgcgattcgtgttttggatgatact
ccggaaaaacttttggagattgaaggaatcggaaagaagaaatgtcaaaagattattgaa
agttacaaagacaaacgggatttaaaagtggcgattcttcatttttcgggctatggactg
actcctgcgatggcaatgaaaatttatcgatattatggagaaaaggcaaaagagattgtg
gaacaaaatccatattgtctatgtcgagatattaagggaatcggatttcgaaaagcggat
gaaattgctgaacgaatgggaattgcaaaaaatgatattcatcgcattatggagggagtt
gtgtatctgttgcaagaggcaggtatgcaaggtcatgtgtatttgccggcggatgttgtg
cgagaacaggcggcgaagttgttgggggtttcgacagaagaggtacaatccggaatttat
gaactttgtatttcaagcaaaacaattttggagcgttcagctgatgaatcggagagactc
tatcttccgttgtatcgtgagacggaaagtaatgtggcgaatttgttatcgcagttgttg
gtgaaggaagaattggatgttggagtagaggcggatactttaattcaagagattcaagat
aagacgggaatttgtcttgccgacaaacagaaagctgccgttacgacagctttgaatgag
aaaattatgattgtaacaggtggtccaggaacaggaaagacaaccgtagtgaagtttatt
ttgaaatgttttgaaaaacaggaaaagaaggttgtgttgtgtgcaccgacgggacgtgca
gcaaagcgtttgactgaagcttccaatcaggatgccaaaaccattcatcgcttgttggag
gttggtttctcagaagatgatgaggagatgaattactacaatcgagatgagcaaaatcct
ttggaatcagatgtgattattgtcgatgagatgtccatggtagatatgtttttgatgagg
gcgcttcttcgagccattcctaaacatgcgaggttgattatgattggagatgcggatcaa
cttccgtctgtcggagcggggaatgtgttgtgggatatgattgagagcaatttgattccg
gttgttcgattgacagagatttttcgtcaagaggaagaaagtcaaattatccaaaatgca
catagggtgaatcatggacaggaactgatcattgataaggagagcaaggacttctttttc
atgatgaggagagatggagacaaggtaaaagatttgattttggagctgataaaagaaaga
cttccgaactattttggagttgagtcgacagaaattcaaattttgactccggttcgcaag
ggtggaatcggaatgcatgaaatcaatcagaaagtacaggaaacactcaatccaccaagt
gaggagcgggcagaatttaagtatatgaataccgtttttcgtgagaatgacaaggtaatg
cagataaagaataattatgaaaaaaagtatcgaaacactgtaacttatgaagagggcgag
ggtgtttttaacggtgatatcggtgtgatagatacggtcgatgttagaggaaaacagttt
tatatcacatttgatgataatcgaagatgtcgatatgaatttgcggaagtcgataatatc
gaacatgcctatgcgattacagtccataagagtcaagggagtgagtttgatgttgtcatt
cttcctattttgtcacttccgccgatgttacagaatcgaaatattttgtatacagcgatt
acaagagcaaaaaaaggattggtcttggtaggaaatatgtattatgtcaatcgcatgatt
caaaatatggatcggcaggagagatactcttctttggcagagagattgaagttcatgaaa
gaacattactttgaagatgaagtatcaaaagaaacatgcccataa

DBGET integrated database retrieval system