KEGG   Ficedula albicollis (collared flycatcher): 101806553Help
Entry
101806553         CDS       T02815                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101806553
Transfer RNA biogenesis [BR:fab03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    101806553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 549 aa AA seqDB search
MKQKRKNGKGELSQAELMVMTIADIIKQLLEAHEQGRDVDINRLKTKTSAKYGLPAQPRL
VDIIAAVPPQFRKVLLPKLKAKPIRTASGIAVVAVMCKPHRCPHINFTGNICVYCPGGPD
SDFEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMAL
PEDYRDYFIRNLHDALSGHTSNNVAEAVRYSERSLTKCVGITIETRPDYCLRQHLSAMLS
YGCTRLEIGVQSVYEDVARDTNRSGGVHGVSNTFSLREKAGFSVISHELRNVKKNAVKKI
LRFSEFFENPAFRPDGMKLYPTLVIRGTGLYELWKTGRYRSYPPSTLVDLVARILALVPP
WTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTQCRDVRTREVGIQEIHHKVRPY
QVELIRRDYVANGGWETFLSYEDPEQDILVGLLRLRRSSPDTFRPELRGGVSVVRELHVY
GSAVPVSSRDPSKFQHQGFGMLLMEEAERIAREEHGARKIAVISGVGTRNYYRKIGYELE
GPYMVKSLE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaaaaaggaaaaatgggaaaggggagctcagccaggctgagctgatggtgatg
accattgctgacatcataaagcagctgctggaggctcatgagcagggcagagatgtggac
atcaacaggctgaagaccaaaacctcagccaagtacgggctgccggcgcagccccggctc
gtcgacatcatcgccgccgtccctccgcagttcaggaaagttctgctccccaaactcaag
gccaagcccatcaggacagccagtgggatcgccgtggtggccgtgatgtgcaaaccccac
cggtgcccccacatcaacttcacaggcaacatctgtgtgtactgcccaggggggcctgac
tctgattttgaatattccacccagtcctacacaggatacgagccaacatccatgagggcc
atccgggctcggtatgatccctatctccagaccagacacagagtggagcagctgaagcag
ctgggccacagcgtggacaaagtggaatttattgtgatggggggcacattcatggcttta
cctgaagattacagagattatttcatcaggaacctccacgatgccttgtcaggtcacact
tccaacaacgtggcagaggctgtcaggtactcggagaggagcctgaccaagtgcgtgggg
atcaccatcgagacgcggccggattactgcctgcggcagcacctcagcgccatgctgagc
tacggctgcacccgcctggagatcggcgtgcagagcgtctacgaggacgtggccagggac
accaacaggtcagggggggtacacggggtctcgaacactttctccctcagagaaaaagca
gggttttctgtaatatcccatgaactgaggaatgttaaaaaaaatgctgtgaaaaaaatc
ctcaggttttctgagttttttgagaaccccgccttccggcccgacgggatgaagctgtac
cccacgctggtgatccgcggcacggggctctacgagctctggaaaacggggcggtaccgg
agttacccccccagcaccctggtggatctggtggccaggatcctggccctggtgccgccg
tggacacgcgtgtaccgcgtccagagagatatcccaatgcctctggtcagctctggggtg
gaacacgggaacctgagggagctcgccctggccaggatgaaggacctggggacgcagtgt
cgcgacgtgaggacgagagaggtcggaattcaggaaatccaccacaaagtgagaccatac
caggtggagctgatccgtcgggactacgtggccaacgggggctgggagacgttcctgtcc
tacgaggaccccgagcaggacatcctggtggggctgctgcgcctgcgccggagctccccg
gacaccttccgccccgagctgcgcggcggcgtctccgtggtgcgcgagctgcacgtctac
ggcagcgccgtgcccgtcagcagccgcgaccccagcaaattccagcaccagggatttgga
atgttgctgatggaggaggcagaaaggatcgccagggaggagcacggggcacggaaaatc
gccgtcatttcaggtgtcggcaccaggaattactacaggaagattggctacgagctggaa
gggccctacatggtgaaaagcttggaatga

DBGET integrated database retrieval system