KEGG   Ficedula albicollis (collared flycatcher): 101806995Help
Entry
101806995         CDS       T02815                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4 (Dombrock blood group)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101806995 (ART4)
Cellular antigens [BR:fab04090]
 Proteins
  101806995 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1A
AA seq 303 aa AA seqDB search
MFFTVCWVDSGKLVTLGSLLLLIFSQILIKEAISPTLALMDMALHSFDDQYLGCREEMIK
ELEQGDYFQKEIAANKDYFHLWKRAQKALLKSPAGLLREMRDSHATVLMAYTMNSSLHSQ
LNWATSTAGISPEHYRHKFSFKYFHFYLTTAIQILKGWQSSMGEQKCYQVHRGVKDSYIE
AKVGSRVRFGHFTSTSRLRNEAQKFGNETLFTVTTCLGAALQGFSYHPSEREVLIPPYEI
FLVKSFFQTQQGNRVHLHSVGNCSKYQCQLLEASRSKNSGYTALASAILPSVLGVSLCLA
HSL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgttctttacagtgtgttgggtggactctgggaagctggtgacactaggcagcctcctg
ttgctgatcttctcacaaatactgataaaagaggctatatcccccaccctggccctgatg
gatatggctctgcattcctttgatgaccagtatctggggtgcagagaggagatgatcaaa
gaactggagcaaggagactattttcaaaaggaaatagctgctaacaaggactactttcat
ctctggaagagggctcagaaggctttgctgaagagccctgcaggactcctgagggagatg
cgtgatagccacgccacagtcctcatggcttacaccatgaactcctccctgcactcgcag
ctgaactgggccacatctacagcaggaatctctccagagcactacagacacaagttcagt
tttaaatatttccacttctacctaacgactgctatccagatattgaagggatggcagagc
agcatgggggaacagaagtgctaccaggtgcacaggggtgtaaaggactcatatatcgag
gccaaggtaggcagcagggtgagatttggacatttcacttctacctcccgcctcaggaat
gaagcccagaagtttgggaatgaaactttgttcacagtgaccacttgcctgggagcagct
ttgcaaggcttttcttaccacccatctgagagggaagtcctcattcccccttatgagata
tttcttgtcaaaagcttctttcagacccagcagggtaaccgtgtgcatctgcattctgtg
gggaactgcagcaagtaccagtgccagctgctggaagcttcaagaagcaagaacagtggt
tacactgcactagcctctgccattctccctagtgtgcttggagtttccctgtgcttggcc
cacagcctctga

DBGET integrated database retrieval system