KEGG   Ficedula albicollis (collared flycatcher): 101807313Help
Entry
101807313         CDS       T02815                                 

Definition
(RefSeq) nuclear receptor coactivator 1-like
  KO
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101807313
Chromosome [BR:fab03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101807313
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 1139 aa AA seqDB search
MSGLGDGAADPAIPESRKRKGSPCDPAQSAEKRRREQEHRYLEELAELLSANIGDIDSLS
VKPDKCQILKKTVDQIQQMKRLEQVGIWEMRMALDGFFFVVNREGRIVFVSENVTGYLGY
GQEELMNSSVYSILHVGDHAEFVKNLLPKSLVNGVPWPQEAPRRSSHTFQCRMLVRPPDE
AGAENAELRQRYEVMQCFTVSQPRAFQEEGEDFQSCLICIARRLPRPAAPAATESFVTKQ
DTTASFCSILVFGIFLGFSQDFPGFSHIFPHNSHVFPSVMTRGTAFSPSYRFTLSDGSVL
ILPFAHTKCKLCYPSSPELQPFIMGIHVIDRDHGILSPQDAPAPGLALPRLNPNVSPGSG
MALPPSLPPSNGSVMAAPSPHPGNSQQNFNPLASNVALNQNNSHPLSHGSSPMNSPGVPA
PQFLSPRHRGSPGLIPRCRAPPGNPFSPSMHSSGGGNSRPFPGNPDANPAAFPAPLRQQN
SQSSPGRLGGKSDSKDGILGEMIQGDAEKTPENPGIPHGSTEGSDAKCPQATSHRLVQLL
ASTAEQQLRHHADADTSSKDSLACAGIAGNSAGNSCPSSHSSLTERHKILHRLLQEGSPS
DVPGLAPEQDKKENPGGNSSAGAAEAEKKKESKDHQLLRYLLDKDEKEAAAAPALSLDDV
KVKVEKGEAAEPCPAAPAAHKMAAGEEGKMEAQGQVGVGSAGMALLVPARIPVRIPIPII
IPIPTAIHILIPIPILIDIPVPIIPVLIPLSILIPIPISIRTPIHIPILIPVPVTIQVPI
ILGEKSAPIAGICGAERNESGMSGMSGMSGVSGVTPLQPSTAARAPTALGSSPAVPAPRA
PFDFCDPGNSGNSGNSGASRGPAQPGSNSGNLPNPPPGRNSGNLPNPFPPDSGMPELELG
VPDAGLGIPGMSEPMPWADPGMAALNRGVLPKPDEPCQLDDLLCPPTTAEGRNDEKALLE
QLVTFLSGRDETELAELDRALGIDKLVQGGGLEALTERFQPHQATAPPLLLEQKPGMFSQ
PSSSSSSSANIPGNFPGMLRQKPPFGAVPVSVPPPPPPPPRGTFPNNSLGIPARQPLSRP
PSAPNQLRLQLQQRLQGQQQLLHQNRQALLNQFGAPVGMNMRAGMQQQLAPQPPLNAQM
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcctcggcgacggcgccgcggatccggcaattcccgaatcccggaagcgcaaa
ggatccccctgcgaccccgcccagagcgcggagaagcggcggcgcgagcaggagcaccgg
tacctggaggagctggcggagctgctgtcggcgaacatcggcgacatcgactcgctgagc
gtcaaacccgacaagtgccagatcctgaaaaaaactgtggatcagatccagcagatgaag
cgcctggagcaggttgggatttgggaaatgagaatggccctggatgggtttttcttcgtg
gtgaaccgggagggcaggatcgtgttcgtgtcggagaacgtgaccgggtacctgggctac
gggcaggaggagctgatgaactccagcgtctacagcatcctgcacgtgggcgaccacgcc
gagttcgtcaagaacctgctgcccaagtccctggtgaacggggtgccgtggccgcaggag
gcgccgcgccgcagcagccacaccttccagtgccggatgctggtgcggccgccggacgag
gccggggccgagaacgccgagctgcggcagcgctacgaggtgatgcagtgcttcactgtc
agccagccccgcgccttccaggaggagggagaagatttccagtcgtgtctgatctgcatc
gcccggcgcttgccccgcccggccgccccggccgccaccgagtccttcgtcaccaaacag
gacaccacagcctccttttgttctattctggtttttgggattttcttggggttttctcag
gatttcccaggattttcccatattttcccccacaattcccatgtttttccctcagtgatg
acgcgtggcacggccttcagcccctcgtaccgcttcacgctgagcgacggctccgtgctg
atcctcccttttgcccacaccaagtgcaagctgtgctacccctcgagccccgagctgcag
cccttcatcatgggcatccacgtcatcgacagggatcacggaattctgtccccgcaggac
gcccccgcgcccggcctggccctccccaggctgaaccccaacgtttcaccgggatcggga
atggcgctgccgccttcccttcccccctccaacggctccgtcatggccgcgccctctccc
caccccggcaactcccaacagaatttcaatccgctggcgtccaacgttgccttaaaccaa
aacaactcccacccgttatcccacggcagctcccccatgaacagccccggcgtcccggcg
ccgcagttcctgtcgccgcggcaccgcggcagccccggtttgatcccccgctgccgagct
cctcccggcaatcccttctcgccgtccatgcactcctccggaggcggcaattcccggcct
tttcccggcaatcccgacgccaaccccgcggcgttcccggcgcccttgaggcagcagaat
tcccaaagttcccccggcagattgggcgggaaatccgactccaaggacggcatcttgggc
gagatgatccaaggcgacgccgagaaaacgccggagaatccgggaattccgcacggatcc
acggagggatcggacgccaaatgccctcaggccaccagccaccgtttggtgcagctgttg
gccagcacggccgagcagcagctgcggcaccacgccgacgccgacaccagctccaaggat
tccttggcgtgcgccggcatcgccgggaacagcgccggcaattcctgcccgtcctcgcac
agctcgctgacggagcggcacaaaatcctgcaccggctgctgcaggagggcagcccctcg
gacgtgccgggtttggcgccggagcaggacaagaaggagaatcccggcgggaattccagc
gccggcgcggcggaggcggagaagaagaaggagtccaaggatcaccagctgctgcggtac
ctgctggacaaggacgagaaggaggcggcggcggcgccggcgctcagcctggacgatgtc
aaggtcaaggtggagaagggcgaggcggcggagccgtgcccggccgcgcccgccgcgcac
aagatggcggccggggaggagggcaagatggaggcgcaggggcaggtgggtgtggggagt
gctggaatggcactgttggtcccggcccggatcccagtccggatcccaatcccaatcatc
atcccaatccccaccgctatccacatactaatcccaatcccaattctaatcgacatccca
gtcccaataatcccagtactaatcccactctcaatcctaatccctatccccatctcaatt
cgaacccctatccacataccaattctaatcccagttccagtcaccatccaagtcccaata
atcttgggggaaaaatcggcgccgattgccgggatttgcggcgcggaaaggaacgaatcg
ggaatgtcgggaatgtcgggaatgtcgggagtgagcggagtgacccctctgcagcccagc
acggccgccagagccccaacggctctgggctcctctccggccgttcccgctcctcgcgct
cccttcgacttctgcgaccccgggaattccgggaattccgggaattccggcgcctcccgc
ggccccgcccaaccgggaagcaactccgggaatcttcccaatccgcccccgggaaggaac
tccgggaatcttcccaatcctttcccgccagattcaggaatgccggagctggagctggga
gttcctgatgccgggttgggaattccgggaatgtcggagccgatgccgtgggcggatccc
gggatggcggcgctgaatcggggagttctgcccaaacccgacgaaccctgccagctggac
gatctcctgtgtccccccacgacggccgagggccggaacgacgagaaggcgctgctggag
cagctggtgacgttcctgagcgggagggacgagaccgagctggccgagctggaccgagcc
ctgggcatcgacaaactcgtgcagggcggcggcctggaggcgctgacggaacgattccaa
ccgcaccaagccacggcgcccccgctgctcctggagcaaaaaccgggaatgttctcccaa
ccctcctcctcctcctcctccagcgccaacattcctgggaatttcccgggaatgctgcgg
cagaagccgcccttcggcgccgtccccgtgtccgtccctcctcctcctcctcctcctcct
cgtggaacattcccaaataattctttgggaattccggcccggcagccgctcagccgcccg
cccagcgcccccaaccagctccgcctgcagctccagcagcgcctgcagggccagcagcag
ctgctccatcagaaccgtcaggcactgctcaaccagtttggggctccggtggggatgaac
atgagggcggggatgcagcagcagctggcgccacagccgcccctgaacgcgcagatg

DBGET integrated database retrieval system