KEGG   Ficedula albicollis (collared flycatcher): 101807637Help
Entry
101807637         CDS       T02815                                 

Gene name
UCHL5
Definition
ubiquitin carboxyl-terminal hydrolase L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101807637 (UCHL5)
Peptidases [BR:fab01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101807637 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 395 aa AA seqDB search
MPEEHFPAAAQQRIPAELRPRLSVSTKTINTRNATAAPGSAPRAPHAQALPGAAPAASPH
SPRIPGPARDPAPRTPLPPRPGKRHLPARPGGCRGAQVEEIWSLEPENFEKLKPVHGLIF
LFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCAHQDIHLGETLSEF
KEFSQSFDAAMKGLALSNSEVIRQVHNSFARQQMFEFDAKSSAKEEDAFHFVSYVPVNGR
LYELDGLREGPIDLGACHQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQR
IAELQQQLAEEEPMDTDQSSNMLSSIQSEVAKYQMLIEEENQKLKRYKIENIRRKHNYLP
FIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQEAK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagaacacttcccagcagcagcacagcagcggatacccgcggagctgcgaccg
cggctgtcagtctccacaaagacgatcaacacgcgtaacgccacagccgcgcccgggagc
gccccgcgggcccctcacgcccaggcgctgcccggagctgcccccgcggcctccccgcat
tccccacgcatccctgggccggcccgggaccccgcaccccgcacgccgctccccccgcgg
cccgggaagcgccacttgcctgcgaggccgggcggctgtagaggagcacaagttgaagaa
atatggagtttggagccagagaactttgaaaagttgaagccagtacatgggctgattttt
ctcttcaagtggcagcctggagaggagccagcgggttctgttgtccaggattccagactg
gatacaatattttttgctaagcaggtgataaataatgcctgtgcaactcaagccatagta
agtgtgctgttaaactgtgctcatcaagacattcatctaggagagaccttgtcagaattt
aaagaattttcccaaagctttgatgctgcgatgaaaggtttggcactgagcaactcagaa
gtgattcggcaagttcacaacagttttgccagacaacagatgtttgagtttgatgcaaag
tcttcagcaaaggaagaagatgcctttcactttgtaagctatgttcctgttaatgggagg
ctatatgagctggatggcttaagggaaggaccaattgatttaggtgcatgccatcaggat
gactggataagtgcagtgcggcccgtcatagagaagcgcatacaaaaatacagtgaaggt
gagataaggtttaacctgatggctattgtgtctgacaggaagatgatatatgagcagagg
attgcagagctacagcagcaactggcagaggaggagcctatggatacagatcaaagtagt
aatatgttaagttctatacaatcagaagttgcaaaataccagatgttaattgaagaagag
aaccaaaaattaaaaagatataagattgaaaatattagaaggaaacataactacctgcct
ttcatcatggaattgttaaagactctagcagagcaccagcaattaataccattagtagaa
aaagcaaaagaaaaacagaatgccaagaaagctcaggaggccaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system