KEGG   Ficedula albicollis (collared flycatcher): 101807854Help
Entry
101807854         CDS       T02815                                 

Gene name
PADI2
Definition
(RefSeq) protein-arginine deiminase type-2
  KO
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     101807854 (PADI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
21
AA seq 675 aa AA seqDB search
MAGEMPGEPRTLRLQHGNRIEALCVLGSHVRADVFGAAPAGAVAFGVKHTEGVSVDVLLR
GREPEAVAGAGARWPLDEGTVLRFSMSRASSEVNDNKVTVSFYADGGKPINQAGVFLTGV
GISLDVDADRDGVVEKNSPNKASWAWGPEGHGAILLVSCDKEFPFIPPSDCGSEQVFDRE
DLLDMAEMVLRTEGPQRLPRGYEIVLSVSANDADNVGVFHVQNPFFGQRYVQVLGRRKLF
HALPYPGGSAELGFFVEGLRFPDETFCGLVSIHASLLERLPQGIPHSPIFTDTVVFRVAP
WIMTPNTLAPVNLFVCSMKDNYLFTKEIQSLVAKASCKLKVCFGYINRGDRWMQDEIRLG
YTHAPHNSFPVVLDSPRERGMEQLPVKELLGPDFGYVHKEPLFEAVASLDSFGNVEVSPP
VSVAGREYPLGRILIGSSFPASAGRRMTRLVRDFLYAQRVQAPVELYSDWLAVGNVNEFV
TFVPASDKKRFRMLLASPAACYRLFREKQKEGQGEATMFKGYSGTDTKRVTINKVLSNEV
LAQQNQYVQRCIDWNRDILKKELGLLEEDIIDLPALFKLDKQGKAVPYFPNMMPMSPAVT
TTHLGIPKPFSATHSAVPGVTMIDMSVHNPFSVTRSAATVPGVTMIDLVSLKGHKFKIPD
VQASNPFGFIEACQG
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggccggggagatgccgggggagccccgcacgctgcggctgcagcacgggaaccgcatc
gaggccctgtgcgtgctgggcagccacgtccgcgccgacgtgttcggggcggcccccgcc
ggggccgtggcctttggcgtgaagcacaccgagggggtcagcgtggacgtgctgctccgc
ggccgcgagcccgaggccgtggccggagccggcgcgcggtggccgctggacgaggggacg
gtgctgaggttcagcatgagccgggccagctccgaggtcaacgacaacaaggtcaccgtc
agcttttacgcggacggagggaagcccatcaaccaagccggggtgttcctcacgggcgtc
gggatctccctggacgtggacgcggatcgggacggggtggtggaaaagaacagccccaac
aaggcgagctgggcctggggaccagagggacacggggccatcctgctggtcagctgtgac
aaggagttccccttcattccgccctccgactgcggcagcgagcaggtgttcgacagggaa
gatctgctggacatggctgagatggtgctgaggacagaggggccccagcgcctgccccgg
ggctacgagatcgtcctctctgtgtctgccaacgacgccgacaacgttggggtcttccac
gtgcagaatcccttcttcgggcagcgctacgtgcaggtgctgggccgcaggaagctgttc
cacgccctcccctaccccggcggcagcgccgagctcggcttcttcgtggaggggctgcgc
ttccccgacgagaccttctgcgggctggtgtccatccacgccagcctgctggagcggctc
cctcagggcatcccccactcgccgatcttcacggacaccgtggtgttccgggtggctccg
tggatcatgacccccaacaccctcgccccggtgaacctcttcgtgtgcagcatgaaggac
aactacctgttcaccaaggagatccagagcctggtggccaaggccagctgcaagctgaag
gtttgcttcggctacatcaaccgcggcgaccgctggatgcaggatgagatcaggctcggc
tatacccacgctccccacaacagcttcccggtggtgctggactcccctcgggagagaggg
atggagcaactccccgtcaaagagctgctgggccccgattttggctacgtgcacaaggag
cccctctttgaggccgtggccagcctggattccttcgggaacgtggaggtcagcccaccc
gtgtccgtggctggcagggagtatcccctgggaaggatcctcatcggcagcagcttccct
gcatccgcgggccgcaggatgaccaggctggtgagggatttcctctatgcccagcgagtc
caggcccctgtggagctctactccgactggctggccgtgggcaacgtcaacgagtttgtc
acctttgtccctgcctctgacaaaaagcggttccggatgctgctggccagtccggccgcc
tgctaccggctcttccgcgagaagcagaaggagggacagggagaagccaccatgttcaaa
gggtactcggggacagacaccaagcgcgtcaccatcaacaaggtgctctccaacgaggtc
ctggcgcagcagaaccagtacgtgcagcgctgcatcgactggaacagggatatcctcaag
aaggagctgggcttgctggaggaggacatcatcgacctgccggccctcttcaagctggac
aagcagggcaaagccgttccctacttccccaacatgatgccaatgtcccctgctgtcacc
acgacccacctgggcatccccaaacccttcagtgccacccattctgctgtccctggtgtc
accatgattgacatgagtgtccacaatcccttcagtgtcacccgttctgccgccactgtc
cccggtgtcaccatgatcgatctggtgtccttgaagggccataaatttaagatcccagat
gtccaagcttcaaatccctttggcttcattgaagcttgtcagggttag

DBGET integrated database retrieval system