KEGG   Ficedula albicollis (collared flycatcher): 101808185Help
Entry
101808185         CDS       T02815                                 

Gene name
MAOB
Definition
monoamine oxidase B
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101808185 (MAOB)
   00330 Arginine and proline metabolism
    101808185 (MAOB)
   00340 Histidine metabolism
    101808185 (MAOB)
   00350 Tyrosine metabolism
    101808185 (MAOB)
   00360 Phenylalanine metabolism
    101808185 (MAOB)
   00380 Tryptophan metabolism
    101808185 (MAOB)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101808185 (MAOB)
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     101808185 (MAOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 521 aa AA seqDB search
MAERCDVVVVGGGISGLSAAKLLTESGLNVVLLEANDRVGGRTFTVRNKQVKYVDLGGAY
VGPTQNRLLRLSKELGIETYKVNEVEHLIHHVKGKSYPFKGPFPPMWNPLAYLDYNNLWR
TMDEMGKEIPNEAPWKAPHAEEWDKMTMQDFIDKICWTKAAKSFATLFVNVDVTSEPHEV
SALWFLWYVKQCGGTTRIFSTTNGGQERKFVGGSGQISERITERLGGRVRLGKPVVRIEQ
SGDGVIVETLDHQLYEGKYVISAIPPALCLKIHFNPPLPPMRNQLINRIPMGSVIKCIVY
YKETFWRKKGYCGTMIIEDEDAAIGLTLDDTKPDGSFPAIIGFILARKCRRLTGLTKEER
KTKLCELYAKVLGSEEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRIIRQPFGR
IYFAGTETATEWSGYMEGAVQAGERAAREILFAMRKIPESEIWKPEPESIDVPALPITTT
FWERNLPSVPGLLKLIGFSTFFTSVAAAGLFAYKKGLLVRN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagatgcgatgtggtcgtggtcgggggcggcatctcaggtctttcagcagcc
aagctactgactgagtcaggcttgaatgtggtgttgctggaagccaatgacagagttggt
ggaagaactttcaccgtaaggaataagcaagttaaatatgtggaccttggaggggcttac
gtggggccaacacagaatcgtctcctgcggctctccaaagagctgggaatagagacatac
aaggtgaatgaagttgagcacctgatacaccatgtcaagggtaaatcttaccccttcaag
ggcccattccctcctatgtggaatcccttggcctacctggactacaacaacctctggagg
accatggatgaaatggggaaggagattcccaatgaagctccatggaaggctccacatgca
gaagaatgggacaaaatgaccatgcaagatttcatagataaaatatgctggacaaaagct
gccaagagttttgcaactctgtttgtgaacgtggatgtcacttctgagccccacgaggtc
tctgccctctggtttctgtggtacgtgaagcagtgtgggggcacaacaagaatattctca
acgaccaacgggggacaggagaggaagtttgttgggggctctgggcagatcagtgagagg
atcacggagcgcctgggcgggcgcgtcaggctgggcaagccggtggtgcgcatcgagcag
tccggggacggcgtcatcgtggagaccctggaccaccagctctacgagggcaaatacgtg
atcagtgccattcccccagctctttgtttgaagattcatttcaacccacctttgccccca
atgaggaaccagctcatcaacagaatccccatgggctcagtcatcaagtgcatcgtgtac
tacaaggaaactttctggaggaagaagggatattgtggtaccatgatcattgaagatgag
gatgctgcaattggtctaacacttgatgacactaagcctgatggcagctttcctgccata
ataggcttcattcttgctcggaagtgcagaagactgacaggtctcacaaaagaagaaagg
aagacgaagctgtgcgagctctatgcaaaggttctgggatcagaggaagctttacatcct
gtgcattatgaagagaagaactggtgtgaagagcagtattctgggggctgctacacagcc
tacttcccaccaggcataatgactcagtatggaaggatcattcggcagccctttggcagg
atctattttgctggcacagagactgccactgagtggagtgggtacatggagggggctgtc
caggctggagaaagagcagccagagagatactctttgctatgaggaagatcccagagagt
gaaatttggaagccagaacctgaatcaattgatgtgccagctttgcccatcactacaacc
ttctgggagaggaacttgccatctgtgccaggactgctaaagctgattggattttccact
ttcttcacctctgtggctgcagctgggttatttgcctacaaaaagggacttctggttcga
aactga

DBGET integrated database retrieval system