KEGG   Ficedula albicollis (collared flycatcher): 101808381Help
Entry
101808381         CDS       T02815                                 

Gene name
MAOA
Definition
(RefSeq) amine oxidase [flavin-containing] A
  KO
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101808381 (MAOA)
   00330 Arginine and proline metabolism
    101808381 (MAOA)
   00340 Histidine metabolism
    101808381 (MAOA)
   00350 Tyrosine metabolism
    101808381 (MAOA)
   00360 Phenylalanine metabolism
    101808381 (MAOA)
   00380 Tryptophan metabolism
    101808381 (MAOA)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    101808381 (MAOA)
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     101808381 (MAOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
1
AA seq 518 aa AA seqDB search
MNPDSEADFASACLSAAKLLSEAGVSVVVLEARDRVGGRTFTIHNDKVNYVDVGASYVGP
TQNRILRLAKELGVETYKVYVEGEMFLHKGGKSRNFAGICPSTWNPFVYLDYNHFWRTMD
KMGKEIPVDAPWDAPHAEEWDKMSMKELINKICWTKAVRDFATAFVNINVTSEPHEVSAL
WFLWYVRQCGGTFRIFSITNGGQERKFKGGSGQISEKIMERLKGRVKLERPVISIDQTGD
NVLVETLNHEIYEGKYVISAIPPILTTKIHCKPELPPKRNQLIQRLPMGSVIKCMMYYRE
AFWRRKGYCGSFMIEDEESPIGITIDDTKPDGTFPAIMGFILARKAVKLAHLSKEERKTK
ICEAYAKALGMKEALQPVHYEEKNWNMEQYSGGCYTAYFPPGIMHSYGRIIRQPVDRIYF
AGTETATQWSGYMEGAVQAGERAAREVLHSMGKISKGEIWMPEPESKDVPALPFPTTFWE
RNLPSAPGLLCLLSCTLCLTSVAAAGFFACKKGLIVRN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctgacagtgaagcagactttgcttctgcatgtttgtcagcagccaaattgctg
tctgaggctggggtcagcgtggtggtccttgaggcccgggacagagttggaggaaggaca
ttcactatccacaatgataaagtgaattatgtagatgttggtgcatcatatgtgggaccc
acccaaaaccggattctgcgactggcaaaagagctgggggtggagacctataaagtgtat
gttgagggtgagatgttccttcataaagggggaaagtcacgaaatttcgcaggaatttgc
ccttcaacatggaatccctttgtttatctggattacaatcacttctggagaaccatggac
aagatgggaaaagagattcctgttgatgcaccatgggatgccccacatgctgaagaatgg
gacaaaatgtccatgaaagagctgataaataagatttgctggaccaaagctgtcagggat
ttcgccacggcctttgtgaacatcaacgtcacatctgagccccacgaagtctctgccctc
tggttcctgtggtatgtgaggcagtgtgggggcacattcaggattttctctatcaccaat
gggggccaggagaggaagtttaaagggggttccggtcagatatcggagaaaataatggaa
cgcctcaaaggcagagttaaactggagagacctgtgatcagtattgatcagacaggtgat
aatgtccttgtggagactctgaaccatgagatatatgagggcaagtacgtgatcagtgcc
atccctccaatcctgacaacaaagattcattgcaaaccagagctgccaccaaagagaaac
cagttaattcagcgtttgcctatggggagtgtcataaagtgcatgatgtactacagggaa
gccttctggaggaggaagggttattgtggttccttcatgattgaggatgaagagtctcca
attggaattaccatagatgacacaaaacctgatggaactttccctgccattatgggtttc
atccttgccagaaaggctgtcaaactggcccatctcagcaaggaagagaggaaaactaag
atctgtgaggcatatgccaaggcactggggatgaaagaggctttacaacctgtgcattat
gaagagaagaactggaacatggagcaatattcagggggctgctacacagcctacttccca
ccaggcataatgcattcctatggaaggatcattcggcagcctgttgacagaatctacttt
gctggcacggagacagcaacgcagtggagtggatacatggagggggccgtgcaggcagga
gagagagcagccagagaggtactgcacagcatggggaagatctccaagggtgaaatttgg
atgccagagccagagtcaaaggatgtcccagccctaccattccccaccaccttctgggag
aggaacctgccctcggcgccggggctgctgtgcctgctgagctgcaccctgtgtctcacc
tccgtggctgctgcggggttctttgcctgcaaaaagggactgatcgttcgaaactag

DBGET integrated database retrieval system