KEGG   Ficedula albicollis (collared flycatcher): 101808403Help
Entry
101808403         CDS       T02815                                 

Gene name
PCSK2
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 2
  KO
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     101808403 (PCSK2)
Peptidases [BR:fab01002]
 Serine Peptidases
  Family S8: subtilisin family
   101808403 (PCSK2)
Chaperones and folding catalysts [BR:fab03110]
 Intramolecular chaperones
  Subtilisin family
   101808403 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
3
AA seq 730 aa AA seqDB search
MDSSPTFLAITDEFSIISRDKGQVADEPVSSSCSTLARTGGLGGTPDIFGSLCRKEKLDG
GSDATFPRSSSGTVPGGVRTQLGWKVPPGPPLLRAPLLLLLLLLLFLLLHFLGAPARGAV
YTNHFLVELHDGGQAEAEQVAAEHGFSGIRKLPFLESGYFFYHNGLAKARRRRSLQHKLR
LEKDSRVRKAVQQEGFIRKKRGYRDINDIDISMNDPLFTKQWYLINTGQADGTPGLDLNV
AEAWELGYTGKGVTIGIMDDGIDYLHPDLASNYNAKASYDFSSNDPYPYPRYTDDWFNSH
GTRCAGEVSAAANNNICGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSAS
WGPTDNGKTVDGPRELTLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWT
ISINSAINDGRTALYDESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAP
EAAGVFALALEANLHLTWRDMQHLTVLTSKRNQLHDEVHRWRRNGVGLEFNHLFGYGVLD
AGAMVKMAKDWKTVPERFHCVGGSIQEPEKIPPSGKLFLTLTTDACEGKENFVRYLEHVQ
AVITVNSTRRGDLNINMTSPMGTKSILLSQRPRDDDSKVGFDKWPFMTTHTWGEDPRGTW
ALEIGFVGSQPQRGVLKEWTLMLHGTQSAPYIDQIVKDYQSKLAMSKKEELEEELDEAVE
RSLKSILSKN
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggacagctcccccactttcttggctataacggatgaattttcaattatctctagggat
aaaggacaggttgctgatgagcctgtgagcagctcgtgcagcactctggctagaacggga
ggtttggggggaactccagatatttttggttcactgtgtcgaaaagagaagctggatggt
ggctccgacgcaaccttcccccgcagctcctcggggacagtacccggaggggttcggaca
cagctcggctggaaggtgccgccggggccgccgctgctccgggcccccctcctccttctc
cttcttctcctcctcttcctcctcctgcacttcctcggcgccccggcccgcggagccgtc
tacaccaaccatttcttggtggagctgcacgacgggggccaggcggaggccgagcaggta
gcggcggagcacggtttcagcgggatacggaagctcccttttttagaatctggatacttt
ttttatcacaatggccttgctaaagccaggagaagacgcagccttcaacacaagcttcgt
ctggaaaaggactccagggtgaggaaagctgtgcaacaggagggcttcatcagaaagaag
cgaggatatagagacatcaatgacattgacatcagcatgaatgatcctttatttacgaag
cagtggtacctgattaacactggtcaagcagatgggactcctggacttgaccttaatgta
gctgaagcatgggagctgggatacacggggaagggagtaaccataggaattatggatgat
ggcattgattatctgcatccagatcttgcatcaaactacaatgccaaagccagctacgac
ttcagcagcaatgatccctacccctatccccgctatacagatgactggtttaacagccac
gggacaaggtgtgcaggagaggtgtctgctgctgccaacaacaacatctgcggcgtggga
gttgcgtacaactccaaagtggcaggtattcgaatgctcgaccagccatttatgacagac
attattgaggcttcctccatcagtcatatgcctcaagtcatagatatatatagtgccagc
tggggaccaactgataatgggaagactgtggatggacctagagagttaacgctgcaagca
atggcagatggtgtgaataagggccggggtggaaaaggcagcatctatgtctgggcctct
ggagatggaggcagctatgatgactgtaactgtgatggttatgcatcaagcatgtggaca
atctccatcaattctgccataaatgatggacggacagctctgtatgatgaaagctgctct
tcaaccttagcctccacctttagtaatgggaggaagagaaatccggaggctggtgtggct
acaacagatttgtatggcaattgcaccctgcgtcattcaggcacatctgcagctgcccct
gaagcagccggagtgttcgccctggccctggaggctaacctgcatctgacatggagagac
atgcagcatctgacagtgctcacgtccaagaggaaccagcttcatgatgaggttcatagg
tggcgtaggaatggtgttgggctggagttcaaccatttgtttggctatggtgtcctagat
gcaggagcaatggttaagatggcaaaagactggaagactgttcctgagagattccattgt
gttggagggtcaatacaggaacctgaaaagataccaccaagtggcaaactgttcctcaca
ctgacaactgatgcgtgtgaggggaaggaaaactttgtccgataccttgaacatgtccag
gcagttataactgtgaattccactcggcgaggagacctcaacatcaacatgacctcacca
atgggaacaaaatccattttgctgagccagcgccccagggatgatgactccaaggtgggt
tttgacaaatggcctttcatgacaactcacacttggggagaagacccccgaggcacctgg
gctctggagattgggtttgtcggcagccagccccagcgaggtgtgctgaaggagtggaca
ctgatgctgcacgggactcagagtgcaccatacatagaccaaattgtaaaagattatcag
tccaaactggccatgtccaagaaggaagagctggaagaagaattagatgaagcagtggag
agaagcctgaagagtatactgagcaagaactag

DBGET integrated database retrieval system