KEGG   Ficedula albicollis (collared flycatcher): 101808403Help
Entry
101808403         CDS       T02815                                 

Gene name
PCSK2
Definition
proprotein convertase subtilisin/kexin type 2
Orthology
K01360  
proprotein convertase subtilisin/kexin type 2 [EC:3.4.21.94]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.94  proprotein convertase 2
     101808403 (PCSK2)
Peptidases [BR:fab01002]
 Serine Peptidases
  Family S8: subtilisin family
   101808403 (PCSK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 714 aa AA seqDB search
MRHPCIGSSFGCFPLRSNLPPQLLGDSTRRGSDTARLEVGGSWCVLRGCSREVRLCRGKA
VEGGSEAWGVPPGPPLLRAPLLLLLLLLLFLLLHFLGAPARGAVYTNHFLVELHDGGQAE
AEQVAAEHGFSGIRKLPFLESGYFFYHNGLAKARRRRSLQHKLRLEKDSRVRKAVQQEGF
IRKKRGYRDINDIDISMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIG
IMDDGIDYLHPDLASNYNAKASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNI
CGVGVAYNSKVAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDNGKTVDGPREL
TLQAMADGVNKGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYD
ESCSSTLASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLHL
TWRDMQHLTVLTSKRNQLHDEVHRWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPE
RFHCVGGSIQEPEKIPPSGKLFLTLTTDACEGKENFVRYLEHVQAVITVNSTRRGDLNIN
MTSPMGTKSILLSQRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWALEIGFVGSQPQRGVL
KEWTLMLHGTQSAPYIDQIVKDYQSKLAMSKKEELEEELDEAVERSLKSILSKN
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgcgccacccgtgtataggctccagcttcgggtgttttcctctccgcagcaaccttccc
ccgcagctcctcggggacagtacccggaggggttcggacacagctcggctggaagtagga
gggagctggtgtgtgctgcgcgggtgcagccgggaggtgcggctttgtaggggcaaggct
gtggaaggtggaagcgaggcgtggggggtgccgccggggccgccgctgctccgggccccc
ctcctccttctccttcttctcctcctcttcctcctcctgcacttcctcggcgccccggcc
cgcggagccgtctacaccaaccatttcttggtggagctgcacgacgggggccaggcggag
gccgagcaggtagcggcggagcacggtttcagcgggatacggaagctcccttttttagaa
tctggatactttttttatcacaatggccttgctaaagccaggagaagacgcagccttcaa
cacaagcttcgtctggaaaaggactccagggtgaggaaagctgtgcaacaggagggcttc
atcagaaagaagcgaggatatagagacatcaatgacattgacatcagcatgaatgatcct
ttatttacgaagcagtggtacctgattaacactggtcaagcagatgggactcctggactt
gaccttaatgtagctgaagcatgggagctgggatacacggggaagggagtaaccatagga
attatggatgatggcattgattatctgcatccagatcttgcatcaaactacaatgccaaa
gccagctacgacttcagcagcaatgatccctacccctatccccgctatacagatgactgg
tttaacagccacgggacaaggtgtgcaggagaggtgtctgctgctgccaacaacaacatc
tgcggcgtgggagttgcgtacaactccaaagtggcaggtattcgaatgctcgaccagcca
tttatgacagacattattgaggcttcctccatcagtcatatgcctcaagtcatagatata
tatagtgccagctggggaccaactgataatgggaagactgtggatggacctagagagtta
acgctgcaagcaatggcagatggtgtgaataagggccggggtggaaaaggcagcatctat
gtctgggcctctggagatggaggcagctatgatgactgtaactgtgatggttatgcatca
agcatgtggacaatctccatcaattctgccataaatgatggacggacagctctgtatgat
gaaagctgctcttcaaccttagcctccacctttagtaatgggaggaagagaaatccggag
gctggtgtggctacaacagatttgtatggcaattgcaccctgcgtcattcaggcacatct
gcagctgcccctgaagcagccggagtgttcgccctggccctggaggctaacctgcatctg
acatggagagacatgcagcatctgacagtgctcacgtccaagaggaaccagcttcatgat
gaggttcataggtggcgtaggaatggtgttgggctggagttcaaccatttgtttggctat
ggtgtcctagatgcaggagcaatggttaagatggcaaaagactggaagactgttcctgag
agattccattgtgttggagggtcaatacaggaacctgaaaagataccaccaagtggcaaa
ctgttcctcacactgacaactgatgcgtgtgaggggaaggaaaactttgtccgatacctt
gaacatgtccaggcagttataactgtgaattccactcggcgaggagacctcaacatcaac
atgacctcaccaatgggaacaaaatccattttgctgagccagcgccccagggatgatgac
tccaaggtgggttttgacaaatggcctttcatgacaactcacacttggggagaagacccc
cgaggcacctgggctctggagattgggtttgtcggcagccagccccagcgaggtgtgctg
aaggagtggacactgatgctgcacgggactcagagtgcaccatacatagaccaaattgta
aaagattatcagtccaaactggccatgtccaagaaggaagagctggaagaagaattagat
gaagcagtggagagaagcctgaagagtatactgagcaagaactag

DBGET integrated database retrieval system