KEGG   Ficedula albicollis (collared flycatcher): 101808729Help
Entry
101808729         CDS       T02815                                 

Definition
7-dehydrocholesterol reductase-like
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Steroid biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    101808729
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     101808729
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 477 aa AA seqDB search
MATHLPKEKKPTEGRKHQHMQNDTKASQGQWGRAWEVDWFSLASIIFLLIFAPLIVYYFI
MSCAQYQCSLADPLLDLLTGNKHLSDIWNSTPTLTYRAAAIYALWVTFQVVLYLFIPDFC
HKFLPGYMGGVQEGAVTPAGVVNKYEINGLQAWIITHVLWFANAYCFHFFSPTIIFDNWI
PLLWCANILGYAVSTFAMIKGYFFPTNAKDCKFTGNFFYDYMMGIEFNPRIGKWFDFKLF
FNGRPGIVAWTLINLSFAAKQQELYGQVTNSMILVNVLQGIYVLDFFWNEAWYLKTIDIC
HDHFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLYTAHAVGTLMLGLLGYYIFRMTNHQK
DLFRRTSGNCRIWGKKPEYIECSYTSVDGSKYYSKLMTSGFWGWARHFNYTGDLMGSLAY
CLACGFKHVLPYFYIVYMTILLTHRCLRDEHRCSSKYGKDWKRYTAAVPYRLLPGIF
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcaacccatcttccaaaggagaaaaaacccactgaaggaagaaaacaccaacacatg
caaaatgatactaaagcttctcaaggccagtggggaagagcatgggaggtggactggttt
tccttggcaagcatcattttcctgctcatctttgcaccactgattgtatattacttcatc
atgtcctgtgcccagtaccagtgctctctggctgatccactcctggacttgctgacaggg
aataagcatctgtctgacatctggaacagcactcccacactgacctatagagctgctgcc
atctatgccctttgggtgactttccaggttgttttgtacttgttcattcctgatttctgc
cataaatttctccctggatatatgggaggtgtacaagaaggtgctgtcacccctgctggt
gtcgtaaataaatacgaaatcaatggacttcaggcctggatcattacccatgtgctttgg
tttgcaaatgcttattgcttccacttcttctcacctaccatcatttttgacaactggatt
cctctcctgtggtgtgccaatatcttgggatatgctgtgtccacgtttgcaatgattaaa
ggctactttttccctacaaatgccaaagactgcaaattcactggaaacttcttttatgac
tacatgatggggattgaatttaaccctcgaatagggaagtggtttgatttcaagctgttc
ttcaatgggcgccctgggattgtggcctggactctaatcaacctttcctttgctgccaaa
caacaggagctatacggtcaagtgacaaactccatgatcctggtcaatgtcctccagggt
atttatgttctggacttcttttggaatgaagcctggtacttgaaaaccattgatatctgc
catgatcattttggatggtatttgggctggggagactgtgtttggttgccttacctctat
actttgcagggtctgtatttggtttaccatcctgtccagctgtacacagctcatgccgta
gggaccttgatgttgggcttgctgggttattacatcttcagaatgaccaaccaccagaag
gacctcttccgtcggaccagtggcaactgcaggatctgggggaagaagccagagtacatc
gagtgctcctacacatccgtggatggcagcaagtactacagcaagctgatgacttctgga
ttttggggctgggcacgtcatttcaactacacaggagacctgatgggctcactggcctat
tgcctggcttgtggctttaagcatgtcctgccatacttctacatcgtttacatgaccatt
ctgctcacccaccgctgccttagggacgagcaccgttgtagcagcaagtatgggaaggac
tggaagcgctacactgctgcagtgccttaccggctcctacccggaatattttaa

DBGET integrated database retrieval system