KEGG   Ficedula albicollis (collared flycatcher): 101809666Help
Entry
101809666         CDS       T02815                                 

Gene name
UCHL1
Definition
ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)
Orthology
K05611  
ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
fab  Ficedula albicollis (collared flycatcher)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 267 aa AA seqDB search
MLEDKPVAPGDASRLPTLPALPALSPRQRQGAGVPLSAGAPRGRACRGRATRSLCPVQVL
SRLGVGPGWRFVDVLGFEDEALRAVPSPACALLLLFPLTEQHENFRKQQTEKIKDQEISS
KVYFLKQTVSNSCGTIGLIHAVANNKDKLKLEEGSALKKFLDETADLSPEERAKHLANNK
AIQEVHNSVAQEGQCRVEDNSVNFHFILFVNVDGHLYELDGRMPFPVNHGTSSDDLLLKD
SAKICRQFTEREKGEVRFSAVAFCKSA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggacaaacctgttgccccgggtgacgccagccgcttgcccacgctgccggca
cttccagcactttctccacgccagcgccagggagccggggtccccctgtccgccggggct
ccccggggacgggcgtgtcgcggccgggccacccgctctctgtgccccgtgcaggtgctg
tcccgcctcggggtgggtcctggctggcgcttcgtggacgtgctgggcttcgaggatgag
gcgctgcgcgccgtgcccagcccggcctgcgcgctgctgctgctgttcccgctcaccgag
cagcatgaaaacttcaggaagcaacagactgagaaaataaaggaccaggagatcagttcc
aaagtgtatttcctgaagcagaccgtcagtaactcctgtgggacaattggtctgatacat
gcagttgctaataacaaagacaaattgaaacttgaggaggggtctgccctgaagaagttt
cttgatgaaacagctgatttgtctcctgaagaaagagctaagcatttggcaaataataag
gctatccaagaagtccacaattctgttgcgcaagaaggacaatgtcgggttgaggacaac
agtgtgaacttccacttcattctttttgtcaacgtggatggacacctgtatgaattggat
ggccgtatgccatttcctgtaaaccatggcacaagctctgatgacttgctgttgaaggat
tctgctaagatctgcagacaatttacggaacgtgaaaaaggagaagttcgtttttctgct
gtggctttctgcaagtctgcttaa

DBGET integrated database retrieval system