KEGG   Ficedula albicollis (collared flycatcher): 101809681Help
Entry
101809681         CDS       T02815                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     101809681
Peptidases [BR:fab01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101809681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 263 aa AA seqDB search
MRCLRLVEEQNPPRRAAQAAGVVAKDTIKGQDRSSSRGPDAWDTKDLGSPRQRYNGFHFC
GGSLISENWVVTAAHCGVRKTDTVVVGAYDQDAPGPDQQKLTIEKVFKNPKFNMLTIHDD
ITLIKLATPAQLSDRVSPVCLPKATDEFDGGLTCVTTGWGLTNPSASQTPAILQQVALPL
LTNAQCKEYWGYRIRDVMVCAGADGASSCMGDSGGPLVCQKDGAWNLVGIVSWGSSTCDP
QTPGVYARVTKLRDWIDSILEAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgtctccggctagtggaggagcagaatccccctcggcgagctgctcaggctgct
ggagttgtagccaaagatacgataaagggacaggatcgctcttcatccagaggtccagat
gcctgggacaccaaggacttgggctctccccgccagcgctacaacggcttccacttctgc
ggcggctccctgatcagcgagaactgggtggtcaccgctgcccactgcggcgtcaggaaa
accgataccgtggtggtgggcgcctacgaccaggacgcacccggccctgaccagcagaag
ctgacgatcgagaaggtcttcaagaaccccaagttcaacatgctgaccatccacgacgac
atcaccctgatcaaactggccactccggcacagctgtcggatcgcgtgtcgcccgtgtgc
ctgcccaaggctaccgacgagttcgatgggggactgacctgcgtcaccactggctggggg
ctcactaaccccagcgcctctcagacgccggcgattctgcagcaggtggctctgcccctg
ctgaccaacgcgcagtgcaaggagtactggggctaccgcatccgcgacgtgatggtgtgt
gccggcgccgacggagcctcttcgtgcatgggcgactccgggggcccgctggtgtgccag
aaggacggcgcctggaacctggtgggcatcgtgtcctggggcagcagcacctgcgacccc
cagacgcccggcgtgtacgcccgcgtcaccaagctccgcgactggatcgactccatcctg
gaggccaactga

DBGET integrated database retrieval system