KEGG   Ficedula albicollis (collared flycatcher): 101809843Help
Entry
101809843         CDS       T02815                                 

Gene name
TGM4
Definition
transglutaminase 4
Orthology
K05621  
transglutaminase 4 [EC:2.3.2.13]
Organism
fab  Ficedula albicollis (collared flycatcher)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 707 aa AA seqDB search
MFSNTEMSLMVTGIDFLKSQNTQQHHTDGYNIKSLVVRRGQPFLVQVSLNRELRPTDKLS
LRFGIGENPMRNRGSLLSLKPEREDFNGWKISVVKKDGKECLLSVTSSPNAPVGKYNLHV
KTTTSIYKPENGAIYLLFNPWCEDDVVYMADEAEKKEYVLNDTGYIYVGSAYSIYDRPWN
FGQFEEFILDACMYLLDKSKLSLNDRRHPANVSRAMSALVNANDDNGVVLGNWSGNYING
TSPMDWIGSVTILQKYYKTKKPVRYGQCWVFAGVLNTVMRCLGVPSRCVSTFDAAHDTEE
NLRVDIYLNEKGEKLNSLSFDSVWNFHVWNDVWMKRTDLPNGFDGWQAIDSTPQEQSQGR
FQCGPCPVKAVREGDVYLPYDSKFVYAEVNADRVYWVVKKVNGKDKYFKVGTETQEIGKN
ISTKAVGQNRRVDITREYKYPEGTKEERMSMQRAYSFLRPSGLTPRSGYASTIQAMGGNI
QPLILKEPVTRTGLQLEINNTEALHPGNPLEMAITVKISAPGNWTVDLTGSCQMQYYTGK
VQANLGTIKETISLEGPSEMQIPMKIAPDAYMKTLSSVEDEVLILVTAIAEVRETNDKLT
KETSMRFQYPPITVQMPETAKLYNDFTCAFIFKNKLNVSLENCKLLVEGLGILKMTTFEL
GDIMPGRIMKSEVICTPTRLGDKKIVAKLISNQIKGISTEKAITITE
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcaatactgagatgagtctgatggtcactgggattgactttctgaagagccag
aacacccagcagcaccacacggatgggtacaacatcaagagcctggtggtgcggcgtggg
cagcccttcctcgtgcaggtcagcctcaacagggagctgaggcccaccgacaagctgtcc
ctgcgctttggcattggtgaaaacccaatgagaaacagggggagcctgctgtcgctgaag
ccggagcgggaggatttcaatgggtggaaaatctctgttgttaagaaggatggcaaagag
tgcctgctgtctgtcaccagctcgcccaacgcccctgtaggaaaatacaacctgcatgtg
aagactacaactagcatttacaagcctgaaaatggtgccatctaccttttgttcaatcct
tggtgtgaagatgatgttgtctacatggctgacgaggcagagaagaaggaatatgtgctc
aatgacaccggctacatctatgttgggtctgcatacagcatctacgacagaccctggaat
tttgggcagtttgaggaattcatcttggatgcctgcatgtatctgctggacaaaagtaag
ctcagcctgaatgatagaaggcatcctgcaaatgtgtccagagccatgtctgctttggtt
aatgccaatgatgacaacggagtcgtgctgggaaattggtcagggaattacatcaatgga
acatcccctatggattggattgggagtgtcaccattttgcagaagtactacaaaaccaag
aagccagttcgttatggccagtgctgggtctttgcaggagtcctcaatacagtcatgcgt
tgcctgggagtgccatcccgctgtgtgagcacttttgatgcggcccatgatacggaggag
aacctgagagttgacatttacctgaacgaaaaaggagaaaagctgaactcattgtccttc
gactctgtctggaacttccacgtgtggaatgatgtctggatgaagagaacagacctgccc
aatgggtttgatggctggcaggcaattgattcaacccctcaggagcaaagtcaaggtcgt
ttccagtgtggcccatgcccggtgaaggctgtccgggaaggagatgtgtatttgccctac
gacagcaagtttgtgtacgcagaagtgaacgctgacagagtctactgggtcgtcaagaag
gtgaacggcaaggacaagtacttcaaggttggcacggagacccaagagatcggcaagaac
atcagcacaaaagctgtggggcagaacaggcgggtcgacatcaccagggagtacaagtac
cctgaaggcaccaaagaggaaaggatgtctatgcaaagagcttacagcttcctacgccct
tcgggattgacgcctcgttcaggctatgcttcgactatacaggcaatgggcgggaacatc
cagcctttgatcctgaaggagccagtcaccaggactgggctccagcttgagataaacaat
acagaagctttgcatcctggcaatccccttgaaatggccatcacagtgaagatttctgct
cctgggaactggaccgttgaccttactggctcctgccagatgcagtactacactggaaaa
gttcaggccaatcttgggactatcaaggagaccatcagtcttgaaggcccatctgagatg
cagatccccatgaaaatagcacccgatgcatacatgaagacgctgtcctccgtggaagat
gaagtgctcatccttgtcactgccattgccgaggtcagggaaacaaacgacaaactcact
aaggagacctcaatgagatttcagtatccccccatcactgtccagatgccagaaacagcc
aaactgtacaatgacttcacctgtgcattcatcttcaagaacaagctgaatgtgagcctg
gaaaactgcaagctgctggtggagggcttgggcatacttaagatgacaacttttgagctg
ggggatataatgcctggcaggatcatgaagtctgaagtaatatgcactccgacaagacta
ggagacaagaaaattgtagccaagctgatctcaaaccagatcaaagggatttctacagag
aaggccatcaccatcaccgagtag

DBGET integrated database retrieval system