KEGG   Ficedula albicollis (collared flycatcher): 101809867Help
Entry
101809867         CDS       T02815                                 

Gene name
CREBBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Melanogenesis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:fab00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101809867 (CREBBP)
   04330 Notch signaling pathway
    101809867 (CREBBP)
   04350 TGF-beta signaling pathway
    101809867 (CREBBP)
   04068 FoxO signaling pathway
    101809867 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101809867 (CREBBP)
  Cellular commiunity
   04520 Adherens junction
    101809867 (CREBBP)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101809867 (CREBBP)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    101809867 (CREBBP)
   05168 Herpes simplex infection
    101809867 (CREBBP)
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101809867 (CREBBP)
Transcription factors [BR:fab03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101809867 (CREBBP)
Chromosome [BR:fab03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101809867 (CREBBP)
Mitochondrial biogenesis [BR:fab03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101809867 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
14
AA seq 2468 aa AA seqDB search
MTGLRDCGETCRGRCEGSTETSPVGQRAECGGRYFGSLFDLENDLPDELIPNGELGLLNS
SGNLVPDAASKHKQLSELLRGSSGSSLTPGIGNVNSSSPGQQGVGAQVQGQPNSASIGSL
GAMGKSPLNPGDSSAPGLAKQAASTSGPTTPASQTLNSQAQKQVGMVTSSPATSQTGPGI
CMNTNFSQTHQSLLNSNSGHSLMNQPQQGQGQVMNGSLGAAGRGRGAGMQYSAPAMQGNA
GSVLAETLTQVSPQMAGHTGLNTAQTGAITKLGMTGNTTPFGQPFSQTGGQQMGAAGVNP
QLPNKPSMANSLSPFPADIKSTPVTSVPNMSQMQSQVQQVGIVPTQAMAAGPTADPEKRK
LIQQQLVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKACQVAHCASS
RQIISHWKNCTRHDCPVCLPLKNASDKRNQQPLLGSPAGGIQNSIGSVGTGQQSTPSLSN
PNPIDPSSMQRAYAALGLPYGNQPQAQLQPQVQGQQPAQPQAHQQMRTINALGANQMNLP
AGGITTDQQPGLISETALPTSLGTNNPLMNDGTNSGNVGNLSSMPTAAPPSSTGVRKAWH
EHVTQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANSRDEYYHL
LAEKIYKIQKELEEKRRSRLHKQGMLGNQAALQTPGPQPPGIPQVAAAMGQAQPVRPPNG
PMSMPTVPISRMQVSQGMNQFNPMSIGNVQMPQAPLGPRAASPMNHPVQMNNMGAVPAMA
MSPSRMPQPQNMMGAHSNNMMGQAPTQNQFLPQNQFPASTGAMNVNNVGMGQSTAQAGVA
QQGQVPSAALPNSLNMLGPQGGQLPCPPVTQPPLHQSTPPVSSAAGMAPMQHQTPPGMTP
PQPAAPTQPSTPVSSSGQTPTPTPGSVPTATQTQSTPTGQTAAQAQVTPQPQTPAQPQSV
PTPQPAQQQPTSVQAQPPGTPLSQAAASIDNRVPTPASVASADTNSQQLGPDAPMLESKS
EVKTEETEPETSETQVEAKTEVEEDLQGSSQIKEETDGTELKQEPMEIEEKKPEMKAEVK
EEEESGTNGTTSQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLL
GIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCTK
LAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKC
FTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDI
IWPSGFVCDNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVR
VVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSD
CPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGD
DYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYF
EGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSI
SRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLHPIVDPDPLLSCDL
MDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHC
TVCEDYDLCINCYNTKSHDHKMVKWGLGLDDESNNQGEQQSKSPQESRRLSIQRCIQSLV
HACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPV
PFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSATPGTPTQQPSTP
QTPQPAPQPQPSPVSMSPAGFPSVSRTQPPTTVSTGKPANPVSAPPPPAQPTGGAAVEAA
RQIEREAAQQQQQQLYRVNNMNNGLPPGRPGLVNPAVGSVNQMPQVSMNVPRPGPVSGPV
MPNMQPGQWQSPPMPQQQPMQPGMARAVMPMATPQAVAGPRMPGVQQPPRSITPNALQDL
LRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVANQPGMQPQAGIQPQPGMQQP
QTGMQQAGMHAQAGLQNMNAMQAGVQRPSVPPQQQGIGAMNPQGQAINIMNPSHNPSMAN
MSPQYREILRRQLLQQQQQQQQQQGGAGMAGGMAAHNQFQQPQGPGGYPQAMQQQRMQQH
LSIQGSSMGQMAQMGQLNQMGQPGLGADGAPNIQQALQQRILQQQQMKQQIGSPGQPNPM
SPQQHMLSGQAQASHLPGQQIATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPH
HVSPQTGSPHPGLAVTMASSMDQGHLGNPEQSAMLPQLNPPNRSALSNELSLVGDTTGDT
LEKFVEGL
NT seq 7407 nt NT seq  +upstreamnt  +downstreamnt
atgacgggattgagggactgtggggagacttgtaggggccgctgtgaggggagcactgag
acatctccggtgggacagagggcagagtgcgggggtcgctatttcggatctttgtttgac
ttggaaaatgatcttcctgatgagctgatccccaatggcgagttgggccttttaaacagc
agtgggaacctcgttccagatgcggcttccaaacacaaacaactttctgaacttctgagg
ggaagcagcggctcttccttgaccccaggaattggcaatgtgaactcgagcagccccggg
cagcagggggttggtgctcaggtccaggggcagccgaacagcgccagcatcggcagtctg
ggcgccatggggaagagcccgctgaacccaggagactcctctgctccaggcctggccaag
caagcagccagcacctctggacctaccacacctgcatcccaaactctgaactctcaagca
caaaaacaagtgggaatggtgacgagcagccctgcaacatcacagactggacctgggata
tgtatgaatactaatttcagtcagacacaccagagccttctcaacagtaattctggtcac
agtttaatgaatcagcctcagcaaggacaagggcaggtaatgaatggatctcttggggca
gctggaagaggaaggggagcaggaatgcaatattctgcccctgccatgcaggggaatgca
ggcagtgtgctggcagagactttaacccaagtatctccacagatggctgggcacaccggg
ctgaacacagcacagacaggagcaattactaaactgggaatgacaggtaacactactccc
tttgggcagcctttcagtcagactggagggcagcagatgggagctgcaggagtgaatcct
cagttgccgaacaagccgagcatggccaatagtctgtctcccttccctgccgacatcaag
agtactcccgtcaccagtgtgccaaacatgtcccagatgcaaagccaggtgcagcaggtg
ggcatcgtcccgacgcaggccatggccgccgggcccacggcagaccccgagaagcgcaag
ctgatccagcagcagctggtcttgctgctgcacgcccacaagtgtcagcggcgcgagcag
gccaacggcgaggtgcgcgcctgcgccctgccccactgccgcaccatgaagaacgtcctc
aaccacatgacgcactgccaggctggcaaggcctgccaagttgcacattgtgcatcttcg
agacaaatcatctcccactggaagaattgtactcggcacgactgtcccgtgtgccttcct
ctgaaaaatgccagtgacaaaagaaaccaacaaccccttttagggtctccagctggtggg
atccagaattccatcggttctgttggtacaggccagcagagcactccatcactaagtaat
cccaatccaattgaccccagctccatgcaacgagcctatgctgccctggggctgccatat
ggcaaccagccccaagcccagctgcagccccaggtccaaggccagcagccagcacagcct
caggctcaccagcagatgaggaccattaatgcactgggagccaaccagatgaaccttccc
gcaggaggaataacaacagaccagcaaccgggtctaatttctgaaactgctcttccaaca
tcccttgggacaaataacccactaatgaatgatggcacaaactctggcaatgttggaaac
ctcagctcaatgccaacggctgcacctccttcgagtaccggggtaaggaaagcatggcat
gaacatgtcactcaggacctgcgcaatcatttagtgcataaacttgtccaagccatcttc
cccactcctgatccagcagcactgaaggatcgccgcatggaaaacttggtggcttatgcc
aggaaagtggaaggagacatgtatgaatctgctaatagtagggatgaatactatcattta
ttagctgagaagatctataagatacagaaggagctagaagagaagaggaggtctcgtctc
cataagcaagggatgctggggaaccaagcagccttacagacccctgggccccagccccca
ggcatcccccaggtggctgctgccatgggccaggcacagcccgtcaggccccccaatggg
ccaatgtccatgccaaccgtgcctatcagtcgtatgcaggtctctcaaggaatgaatcag
tttaaccccatgtccatagggaatgtacagatgccccaagcaccgctgggcccgcgggcg
gcgtctccgatgaaccacccggtgcagatgaacaacatgggcgccgtgcccgcgatggca
atgtctccttcccgaatgcctcagccacagaacatgatgggagctcattccaacaatatg
atgggtcaggctcctacccagaaccaattcctgccccaaaaccagttcccagcatccact
ggagctatgaatgtgaacaatgtgggcatgggtcagtcaacagcccaggccggggtggca
cagcaggggcaggttcccagtgctgctcttcccaactcgctgaacatgctggggccgcag
ggcgggcagctgccgtgtcccccggtgacgcagccccccctgcaccagagcacacctccc
gtgtccagtgctgccgggatggcacccatgcagcaccaaacccccccgggaatgactcct
ccccagccagcagcgcccacccagccatcgacgcccgtctcctcctcgggacaaactccc
accccgacgccgggctctgttcccacggccacgcagacccagagcacccccacggggcag
actgcggcccaggcccaggtgacaccgcagccacagacccctgcccagccccagtctgtg
ccaaccccgcagccagcccagcagcagccaacctctgtgcaggcacagccacccggcact
ccactatcccaggcagcagctagtattgataacagggtccccacccctgcctcagttgct
agtgctgatacgaattcccagcaactaggaccagatgcaccaatgctagaaagcaaatca
gaagttaaaactgaagaaactgagccagagactagtgagacacaagtggaagctaagact
gaggtggaggaggatttacaaggatcttcacaaataaaagaagaaacagatggaacagaa
ctgaagcaggagccaatggaaattgaagaaaagaagcctgaaatgaaagcagaggttaaa
gaggaggaggagagcggcactaatggaaccacttcacaatccacatcaccatcccagccc
cgcaagaaaattttcaagcccgaggagctgcgccaggctctgatgcccaccctggaagct
ttgtaccggcaggaccctgagtcccttcctttcagacagcctgtggatccccagctctta
gggattccggattattttgacattgtgaagaatcccatggatctgtcgaccatcaagcgc
aagctggacacggggcagtaccaggagccctggcagtacgtggatgacgtgtggctgatg
ttcaacaacgcctggctctacaaccgcaagacctcccgcgtttacaagttctgcactaag
ctggctgaggtgtttgagcaagagattgatccagtcatgcagtccctgggctactgctgt
ggccgcaagtatgagttctctccccagaccttgtgctgctatggcaagcagctgtgtaca
attccccgggacgctgcctactacagctaccagaacaggtatcacttctgtgagaagtgt
ttcactgaaatccagggggagaatgtcaccctgggtgatgacccttcccagcctcaaaca
accatctctaaggatcagtttgaaaagaagaagaacgataccctggatccagagccgttt
gttgactgcaaagaatgtggtcggaagatgcaccagatttgtgtgttacattatgatatt
atttggccttcagggtttgtctgtgataattgtctgaagaaaactggtagaacacgcaaa
gaaaacaaattcagtgctaaaaggctgcagaccacacgtttagggaaccacttggaagac
agagtgaacaaattcctgcggcgccagaaccatcctgaggctggagaggtctttgtcaga
gtggtagcaagttcagataagacagtagaagttaaaccaggaatgaaatccagatttgtg
gactctggtgagatgtcagaatccttcccttaccgtaccaaagctctgtttgcgttcgag
gagatcgacggcgtggacgtgtgtttttttgggatgcatgtgcaggagtatggctcagac
tgcccccctccaaacaccaggcgtgtgtacatctcctacctggacagtattcacttcttc
cggccccgctgcctccgcactgccgtgtaccacgagatcctcatcggctacctggagtac
gtcaagaaacttgggtatgtgacagggcacatctgggcctgtccccccagtgaaggagat
gattacatctttcattgccacccacctgaccagaaaatacccaaacccaagcgattgcaa
gaatggtataagaagatgctggacaaggcatttgctgaaagaatcattcacgactacaag
gacatcttcaaacaagcaactgaggacaggctgaccagtgccaaggagctgccttacttt
gaaggtgacttctggcccaatgtgctggaggaaagcattaaggagctggagcaggaggag
gaggagaggaagaaggaagagagcactgcagctagtgaaacaacagaggggagccagggc
gacagcaagaacgccaagaaaaagaacaacaaaaaaaccaacaagaataagagcagcatc
agcagagctaacaagaagaagcccagcatgccaaacgtgtccaatgacctgtctcagaag
ctctacgccaccatggagaagcataaagaggtgttttttgtgatccatttacacgccggg
cccgtcattaacaccctgcaccccatcgtggaccccgacccgctgctgagctgcgacctg
atggacgggcgggacgccttcctgacgctggccagggacaagcactgggagttctcctcc
ctgcgccgctccaagtggtccacgctgtgcatgctggtggagctgcacacgcagggccag
gaccgcttcgtctacacctgcaacgagtgcaagcaccacgtggagacccggtggcactgc
accgtctgtgaggattacgacctctgcatcaactgctacaacactaagagccatgaccac
aagatggttaaatggggcctgggtctggatgatgagagcaacaaccagggagagcagcag
tccaagagcccgcaggagtcgcgccggctgagcatccagcgctgcatccagtccctggtc
cacgcctgccagtgccgcaacgcaaactgctctctgccgtcctgccagaagatgaaacgg
gtcgtgcagcacaccaagggctgcaagcgcaagaccaacggtggctgcccggtgtgcaaa
cagctcatagctctttgctgctaccatgccaaacactgccaagagaacaaatgccccgtg
ccattctgtctcaatatcaaacacaagctccgacagcagcagatccagcaccgcctgcag
caggcgcagctcatgcgcagaaggatggcgaccatgaacacccgaaacgtgcctcagcaa
agtttgccttctcctacctcagcaacgcctggtacccctacgcagcagccaagtacaccg
cagacgccgcagcctgcgccccagccccagccctcccctgtaagtatgtcaccggccggc
ttccccagcgtctccagaacccagccccccaccacggtctccacaggaaaacccgccaac
ccggtgtcggcgccgccgcctccggcccagccgacggggggggccgccgtggaagcggct
cggcagatcgagagggaggctgcccagcagcagcagcagcagctctacagggtcaacaac
atgaacaatggtttgccccccggccgcccggggctcgtgaaccccgcggtgggctcggtg
aaccagatgccgcaagtcagcatgaatgtaccccggcccggccccgtgagcggccccgtg
atgcccaacatgcagcccgggcagtggcagtcgccgcccatgccgcagcagcagccgatg
cagccgggaatggccagagcggtgatgccgatggcgacgccgcaagccgtggccgggccc
aggatgccgggcgtgcagcagccgccgcgcagcatcacccccaatgcacttcaggacttg
ctgaggaccctgaaatcgccaagttctccgcagcagcagcagcaggttcttaatatcctt
aaatccaaccctcagcttatggcagcttttataaagcaaagaacggccaaatacgtggcg
aaccagcccgggatgcagccgcaagcggggatccagccccagcccgggatgcagcagccg
cagaccggcatgcaacaggcaggcatgcacgcgcaggcgggactgcagaacatgaacgcc
atgcaagccggagtgcagagaccgagcgtccccccgcagcagcaagggatcggagctatg
aacccccagggccaagcgatcaacatcatgaaccccagccacaaccccagcatggccaac
atgagcccgcagtaccgcgagatcctgaggcggcagctactgcagcaacagcagcagcag
cagcagcagcagggaggggccggcatggcaggagggatggcagcacacaaccagttccag
cagccccaaggcccgggaggttacccccaagccatgcagcagcagcggatgcagcagcac
ctatccatacagggcagttccatgggacagatggctcagatgggacagctgaaccagatg
ggccagcccggcctgggggcggacggcgctcccaacatccagcaggccctgcagcagcgc
atcctgcagcagcagcagatgaagcagcagatagggtcccccgggcagcccaaccccatg
agcccacagcagcacatgctctcaggacaagcgcaggcgtctcatctccctggccagcag
atcgccacctccctcagcaaccaggtgcggtccccagcgcccgttcagtctccccgtccc
cagtcccagccaccacattccagcccgtctccccggatacagccccaaccgtcaccgcac
cacgtctctccccagactggttccccccacccaggactcgcagtcactatggctagctcc
atggatcagggacacttgggcaacccagaacagagtgcaatgcttccccaactaaacccc
cccaaccgcagtgcgttgtctaacgaattgtctctggtcggtgacaccaccggggacaca
ttagagaaatttgtggagggtttgtag

DBGET integrated database retrieval system