KEGG   Ficedula albicollis (collared flycatcher): 101809895Help
Entry
101809895         CDS       T02815                                 

Gene name
GPD1L
Definition
glycerol-3-phosphate dehydrogenase 1-like
Orthology
K00006  
glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101809895 (GPD1L)
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)
     101809895 (GPD1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 353 aa AA seqDB search
MALSAAPLKVCVVGSGNWGSAVAKIIGNNVKKLQKFASTVNMWVFEENINGRKLTDIINN
DHENVKYLPGFKLPDNVVAIPNLREAVQDADLLVFVIPHQFIRKVCDEITGQVPRKALGI
TLIKGIDEGPEGLKLISDIIREKMGIDISVLMGANIASEVAAEKFCETTIGCKILENGLL
FKELLQTPNFRITVVDDADAVELCGALKNIVAVGAGFCDGLCYGDNTKAAVIRLGLMEMI
AFAKFFCKGQVSTATFLESCGIADLITTCYGGRNRRVAEAFVKTGKSIEELENEMLNGQK
LQGPQTSAEVYRILKQKEMLDKFPLFTAVYQICYEGRPVEEIIACLQSHPEHK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcgctctccgccgcccccctcaaggtctgcgtcgtgggctcgggcaactggggttct
gcggttgccaaaataataggtaataatgtaaaaaaattgcagaagtttgcttccacagtg
aacatgtgggtctttgaggagaatattaatgggcgaaaactgacagatatcataaataat
gaccatgaaaatgtaaagtatcttcctggattcaagcttccagataatgtggttgctatc
ccaaaccttcgtgaagcggtacaggatgcagacttgctggtttttgtcattcctcatcag
ttcatccgtaaagtctgcgatgaaatcacaggacaagtacccaggaaagcgcttggcata
actctcataaagggaatagatgaaggcccggagggactcaaactgatctctgacattatt
cgagagaagatgggaatagacatcagtgtgctgatgggagctaacattgccagtgaggtg
gcagcagagaaattctgtgaaaccacaataggctgcaaaatcttggaaaatggccttctc
ttcaaagaactcctacagactccaaacttccgaataactgtagtagacgatgcagatgca
gttgagctgtgtggtgctctgaagaatatagtagcagtaggagctggtttctgtgatggc
ctttgctacggtgacaataccaaagctgctgttattcgccttggcctaatggagatgatc
gcctttgccaaatttttttgcaaaggacaagtttctactgccactttcctggagagctgt
ggcattgctgatctcatcacaacgtgttatggtggcaggaatcgacgtgtagcagaagca
ttcgttaaaactggaaagtctattgaagaattggagaatgaaatgttgaatggtcagaaa
ctccaaggaccacagacttctgcagaagtgtatcgcatcctgaagcagaaagaaatgctg
gacaagtttccgctcttcacagctgtgtatcaaatctgctatgaagggagacctgttgaa
gagataatagcctgccttcaaagtcatccagagcacaagtaa

DBGET integrated database retrieval system