KEGG   Ficedula albicollis (collared flycatcher): 101810153Help
Entry
101810153         CDS       T02815                                 

Definition
thymidine phosphorylase-like
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101810153
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101810153
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     101810153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1A
AA seq 132 aa AA seqDB search
MRRILERVGCCIVGQSAELVPADRVLYGLRDVTATVDSLPLITASILSKKAAERLSALVL
DVKFGGAALYPTQESARELARSLVTPRDPRDPCPLSRAIPAVPVLAPAPAPGCPCPHVSP
PCLLSPRLSLVP
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcatcctggagcgggtgggctgctgcatcgtggggcagagcgcggagctggtg
cccgccgaccgggtgctctacgggctgcgcgatgtcacggccaccgtggacagcctgccc
ctcatcaccgcctccatcctcagcaagaaggcggcggagcggctctcggcgctggtgctc
gacgtcaagttcgggggcgcagctctgtaccccacccaggagagcgcgcgggagctggcg
cggagcctggtgacacctcgggacccccgggacccctgcccgctgtcccgggccattccc
gctgtccctgtccttgctcctgcccctgcccctggctgtccgtgtccccacgtgtcccct
ccctgcctgctctcaccccggctgtccctcgtccct

DBGET integrated database retrieval system