KEGG   Ficedula albicollis (collared flycatcher): 101810153Help
Entry
101810153         CDS       T02815                                 

Gene name
TYMP
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00240  Pyrimidine metabolism
fab00983  Drug metabolism - other enzymes
fab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101810153 (TYMP)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101810153 (TYMP)
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     101810153 (TYMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_3
Motif
Other DBs
NCBI-GeneID: 101810153
NCBI-ProteinID: XP_005039013
Position
1A
AA seq 147 aa AA seqDB search
MRRILERVGCCIVGQSAELVPADRVLYGLRDVTATVDSLPLITASILSKKAAERLSALVL
DVKFGGAALYPTQESARELARSLVTPRDPRDPCPLSRAIPAVPVLAPAPAPGCPCPHVSP
PCLLSPRKVRGTPTPNPPAHTLHLGGP
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcatcctggagcgggtgggctgctgcatcgtggggcagagcgcggagctggtg
cccgccgaccgggtgctctacgggctgcgcgatgtcacggccaccgtggacagcctgccc
ctcatcaccgcctccatcctcagcaagaaggcggcggagcggctctcggcgctggtgctc
gacgtcaagttcgggggcgcagctctgtaccccacccaggagagcgcgcgggagctggcg
cggagcctggtgacacctcgggacccccgggacccctgcccgctgtcccgggccattccc
gctgtccctgtccttgctcctgcccctgcccctggctgtccgtgtccccacgtgtcccct
ccctgcctgctctcaccccggaaggtcagggggacccccaccccaaacccccctgcccac
accctgcacctcgggggtccctga

DBGET integrated database retrieval system