KEGG   Ficedula albicollis (collared flycatcher): 101810669Help
Entry
101810669         CDS       T02815                                 

Gene name
ALDH18A1
Definition
aldehyde dehydrogenase 18 family, member A1
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fab01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fab00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 813 aa AA seqDB search
MISLICRRHLKMLCRAALSPLVRSPGWCFVLPPHAIAAISRLYLPCHNQRLRNECIRCWS
NIPFITLPLSRAHGKSFAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSV
LQNQGREMMIVTSGAVAFGKQRLRHEILLSQSVRQALHSGQSQLKDMAIPVLEARACAAA
GQSGLMALYEAMFTQYSICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIINTNDA
VVPPPEPNSDLQGVNVISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLI
DIFYPGDQQSVTFGTKSRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKISGHVITDIV
EGKKVGTFFSEVKPAGPTVEQQAEMARAGGRTLAALQPEQRAEIIYRLADLLTDQREEIL
LANKKDLEEAENKGRLALPLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVIRRTRIAK
DLDLEQVTVPIGVLLVIFESRPDCLPQVSALAIASGNGLLLKGGKEAAHSNQILHHLTQE
ALSIHGVRDAVQLVNTREEVEDLCRLDKLIDLIIPRGSSQLVRNIQKAAKGIPVMGHSEG
ICHVYVDTDASVEKVTRIIRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQV
KIHAGPKFASYLTFSPSEVKSLRTEYGDLECCIEVVDSVQEAVEHIHKYGSSHTDVIITE
NEKTAEFFLQHVDSACVFWNASTRFSDGYRFGLGAEVGISTSRIHARGPVGIEGLLTTKW
LLRGNNHVVSDFSEHGSMKYLHESLPLPQRNAN
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgatatccttgatttgcagaaggcatctcaaaatgttgtgtcgagctgctctgagccct
cttgtccgttcccctggatggtgctttgtgttaccgccccatgccatcgcagccatttcc
cgtttatatctcccttgccataaccaaagattaaggaatgaatgcatccgttgttggagc
aatattccatttatcactttgccactcagccgtgcacatggaaaatcatttgcacaccgc
agtgagctgaagcatgcaaaacggattgtagtaaagctgggtagtgctgttgttactcga
ggggatgagtgtggcttggcccttgggaggctggcttccattgtagagcaggtctcagtg
ctgcaaaatcagggccgagagatgatgattgtcaccagtggggctgtagcttttggaaag
cagcggttgcgtcatgagatcctgctttctcagagtgtgaggcaagcacttcattcaggc
cagagtcagctgaaagatatggctattccagtcttggaggcccgagcctgtgcagcagct
ggacagagtggactaatggctctgtatgaggccatgtttacacagtacagcatctgtgca
gctcagattttagtcaccaatctggatttccatgatgagcagaagcgtcgcaacttaaat
ggaacattacatgagcttttaaggatgaatattgtccctataattaacactaacgatgca
gttgttccacctccagagccaaacagtgatcttcagggggtaaatgtaattagcgtgaag
gataacgacagtctggcagcacgactggctgtggaaatgaaaacagatctcctgattgtt
ctttcagacgtagaaggactctttgacagcccgccagggtctgatgatgcaaagcttatt
gacatattctacccaggagaccagcagtctgtaacatttggaaccaaatcccgagtggga
atgggtggcatggaagccaaggtgaaagcagctctttgggccctgcaaggaggcacttca
gtagtgattgcgaatgggacccacccaaagatctcaggtcatgtcatcacagatattgta
gaagggaaaaaagttggaacttttttttcagaggtaaaacctgcaggccctactgtagaa
cagcaggctgaaatggctcgagctggtggcaggaccttggcagctctacagcctgagcag
agagcagagattatttatcgtcttgctgacttactaacggaccagagagaagaaattctc
ttggcaaacaaaaaggacttagaggaggctgaaaataaagggagattagcactccctttg
ttgaaacgcctaagtctgtccacttcaaagctgaacagcttggctattggtctgcgtcaa
attgcagcatcctcgcaggacagtgtcggccgtgtaattcgacgaactcgaatagcaaaa
gacctggatttggagcaggtgacagtgccgattggtgtccttctcgtgatctttgaatct
cgtcctgactgtcttccacaggtgtctgctttggccatagccagtggaaatggcttacta
cttaaaggtgggaaagaggcagcacatagcaatcaaatccttcatcatctgacacaagaa
gcactctctattcatggagtcagagatgcagtgcaactggtgaacacaagagaggaagta
gaagatctctgccgtttggataagctgatagatctcatcattccacgtggttcatcacag
ttagtcagaaacatccaaaaagctgctaagggaatcccagtgatgggacacagtgaaggg
atctgtcatgtctatgttgacacggatgccagtgttgagaaggtcacacgaataatcaga
gactcaaagtgtgaatatcctgctgcctgtaatgctctggaaactctcttaattcatcga
gacttgctgagaaccccgttgtttgatcagatcatagacatgttgagagtagaacaggtg
aagattcatgctggcccaaagtttgcatcgtacttgacattcagtccttcggaagtgaaa
tctctgcgcacagagtatggggacctggagtgctgcattgaggtggtagacagtgttcaa
gaggctgttgaacatatccacaagtatggaagttcccatacggatgttattatcacagag
aatgagaaaacagcagagttcttcctccagcacgtggacagtgcttgtgttttctggaat
gccagtacccgattctctgatggctataggtttggacttggtgctgaagtgggaattagt
acttcacgtatccatgcacgtggaccagtgggaattgaaggactcttaactacgaagtgg
ttgctgagggggaacaatcatgttgtttctgacttttcagagcatgggagcatgaagtat
cttcatgaaagcctccctctccctcagagaaatgccaactaa

DBGET integrated database retrieval system