KEGG   Ficedula albicollis (collared flycatcher): 101810784Help
Entry
101810784         CDS       T02815                                 

Gene name
EP300
Definition
E1A binding protein p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Influenza A
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:fab00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101810784 (EP300)
   04330 Notch signaling pathway
    101810784 (EP300)
   04350 TGF-beta signaling pathway
    101810784 (EP300)
   04630 Jak-STAT signaling pathway
    101810784 (EP300)
   04068 FoxO signaling pathway
    101810784 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101810784 (EP300)
  Cellular commiunity
   04520 Adherens junction
    101810784 (EP300)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101810784 (EP300)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    101810784 (EP300)
   05168 Herpes simplex infection
    101810784 (EP300)
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101810784 (EP300)
Transcription factors [BR:fab03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101810784 (EP300)
Mitochondrial biogenesis [BR:fab03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101810784 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1A
AA seq 2447 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSVSASDGTDFGSLFDLEHDLPDELISSTELGLTNGGD
INQLQTSLGLAQDAASKHKQLSELLRAGSSPNLNMGVGGPGQGMASQTQQNSPGMGMLNS
MVKSPMAQAGLTSPNMAMGASGPNQGPSAQSTAAMMPTVNSPVNQPGMGMNTGMNAGMNP
GMLAAGNGQGMMQGQVMNGSIGAGRGRPNMPYPNPGMGSAGNLLAETLQQGTPQMGGQAG
LRGPQPGAMNKIGMMSNPSPYGQPYSQNTGQQIGASGLGPQMQNKAGLQNSLPQFPMDKK
PVPGAGMPNMGQQQAPQVQQAGMGPAASQGMGSGAPTADPEKRKLIQQQLVLLLHAHKCQ
RREQANGEVRQCNLPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCP
VCLPLKNAGDKRNQQSLLGGAAVGLANTGSVGVGQQTTPSINTTSQIDPSSIERAYAALG
LTYQGNQMQTQPQAQVKNQQQGQSPQGLRPMNPMNANPMGVNGGVGVQPPNLLPDSMLHS
TMNSQNPMMSESANVASLGAMPTAQPSNAGIRKQWHEDITQDLRNHLVHKLVQAIFPTPD
PAALKDRRMENLVAYARKVEGDMYESANSRAEYYHLLAEKIYKIQKELEEKRRTRLQKQN
MIPNAPGMPQAPMNQGPNMGQPQPGMSANGPLPDPTLIRANVPNQMMNRMQAQPGMNQFG
QMNMQLSPMGPRQTPPLQHPGQLSQAGAMNQMGFPSRMQQPGVGQPSGQNQFLQQTQFPA
SSPGMNTASMPMTQPGNQTPVSQAQMTSASCPVNSPAMAPGSQGSHIHCPPLPQPPMHQN
SPSPVPSRTPTPHHTPPGLGSQQQQAAAAAATTAPTPAPQAMPPGPQSQTMHPPQRQTPT
PPQTQLPPQVQPPVPVTPSAEQQQQPLSQQSTTASVPTPTAPLQPQHPTTPLSQPAVSID
GQVSNPPSTSSTEVNSQQTVPEQQQPPLQEVKMEIKTEEGEPEQTEMQMEEKSETKVEPV
VEECKPDPMEQEEKKPEMKTEVPEGEERPTTPATQSSPAAGQSKKKIFKPEELRQALMPT
LEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDI
WLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQ
LCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDP
ELFVECIECGRKMHQICVLHNEIIWPSGFVCDGCLKKTGRTRKENKFSAKRLPATRLGTF
LENRVNDFLRRQNHPEAGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALF
AFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGY
LEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKSVSERIVH
DYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVS
KGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLI
AGPAANSLPPIIEPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQ
SQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQT
ATTQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPI
CKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQLQHRLQQAQMLRRRMASMQRTGVA
GQQQGLPSPTPATPTTPTGQQPPTPQTPQPQPPPQPVSQPQPAPPNSMPPYTMPRTQPPS
AVSQGKAGGQVTPPTPPQPPQPPVQGPPPAAVEMAMQIQRAAETQRQMAQVQIFQRPIQH
QMPQMPPMGMNPPQIGRGPGGHIDQGMGPAGIQQQPPWVQGALPQAQLQPGMQRPSMMSV
AQPGQPMNMAPQPGMGQVPGAAQSKQPPLPQAALQNLLRTLRSPSSPMQQQQVLNILHSN
PQLLAAFIKQRAAKYAGSQNPQGMAGQPGLPQGQPGLQPQQAMQGQQAGVHPNAAMQNMN
PMQAGVQRPSMPQQQPQQQPQQAMAGMNPQAQQMNMNHSGMAPQFRDLLMRRHQMMEQQR
HQQQQQQGAGPALGPGMANHNQFQQPQGVGYPQQQQQRMQHHMQQMQQGNMGQISQLPQA
MSAETGASLQQAFQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQLPSSLTNQV
RSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMDQGHFASP
DQSAMLSQLASNPGMAGLHGTSATELGLSSENSDLNSNLSQSTLDIH
NT seq 7344 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggagccgggcccgccttcagccaagcggcctaaactctcctca
ccggcgctctccgtgtccgccagcgacggcacagattttggatcactctttgatctggaa
catgacttgccagatgaactgatcagctccacagaacttggactcaccaatggcggtgac
attaatcagctgcagaccagccttggcctggcacaagatgctgcctctaaacacaagcag
ctgtctgaacttctacgggctggtagctccccaaatctcaatatgggggttggtggccct
ggccaaggcatggccagtcaaacccaacaaaatagtcctggaatgggaatgttaaatagc
atggtgaaaagccccatggcacaggctgggttgacttctcccaatatggcgatgggtgcg
agtggaccaaaccagggtccttctgctcaatccacagctgcaatgatgccaacagtgaac
agcccagttaaccagcctggcatgggaatgaacacagggatgaatgctggcatgaatcct
gggatgttggcagcaggcaacggacaggggatgatgcaggggcaagtcatgaacggttca
attggagcaggcagagggcgacccaatatgccgtacccaaacccaggcatgggcagtgct
ggtaacttgttggctgagacactgcaacaaggcactccacagatgggagggcaggctgga
ctgagagggccacagcctggagccatgaacaagattggaatgatgagcaatcccagccct
tatggccagccctatagtcaaaatactgggcagcagattggagccagtggacttggccct
cagatgcagaataaagctggactgcagaatagcttaccacagtttccaatggacaagaag
ccagttcctggggcaggaatgcctaacatgggccagcagcaggctccccaagtacagcaa
gctgggatggggccagcagcttctcaaggcatggggtctggagcaccgacagcagatcca
gaaaagcgcaaactcattcagcagcagctcgttctcctcttacatgctcacaagtgtcag
cgccgagagcaggccaacggggaggtgcggcagtgcaacctcccgcactgccgaaccatg
aagaatgtcctgaaccacatgacacattgtcaggctggcaaatcttgccaagtggcacat
tgcgcatcttcccgacaaatcatctcacattggaagaattgtacaagacatgattgtcct
gtatgtttgccgctcaaaaatgctggagacaaaagaaatcagcaatcgctgctgggcgga
gctgcggtaggacttgccaataccggctctgtgggcgtggggcagcagacaacgcccagc
atcaacactaccagtcagatagaccccagctccatcgagagagcctatgcagccctcgga
ctcacctatcaaggcaaccagatgcagacacagccccaggctcaagtcaagaatcagcaa
cagggacagtcgccccagggtctgcgccccatgaatcctatgaatgcaaacccaatggga
gtgaatggaggagtaggggttcaaccccctaatctgctgcctgactcaatgttacattca
accatgaattctcagaaccccatgatgagtgaaagcgccaatgttgccagtttgggagcc
atgccaacagctcaaccatccaatgccggaattcgaaagcagtggcatgaagacattact
caggatctccgaaaccaccttgttcataaattagtccaagccatatttcctactcctgac
cctgcagctttgaaggatcgacgtatggagaatctggtggcatatgctcggaaagtggaa
ggggacatgtatgaatcagcaaacagcagggcagagtactatcacttgctagcagagaag
atctacaagattcagaaggagttggaggagaaacgaagaacaaggctgcagaagcaaaat
atgattccaaatgctccaggcatgccacaagctcccatgaatcaagggcccaatatggga
cagccacagccaggaatgtctgcaaatggtcctcttcctgacccaaccttgatacgtgcc
aatgtgccaaaccagatgatgaatcgcatgcaggcacagccaggaatgaatcagtttggc
cagatgaacatgcagctgtcaccgatgggaccccgacaaacccctcctcttcagcaccct
ggacagctaagtcaggccggggccatgaaccagatgggatttccttcacgtatgcagcaa
ccaggagttggccagccttctggtcagaatcaatttctacaacagactcagttccctgct
tcttccccaggaatgaacacagcaagcatgcctatgactcagcctggcaatcagacacca
gtatctcaagcacaaatgaccagcgcttcctgtcctgtgaactctcctgcaatggctcca
ggttctcaagggagccatattcactgcccacctcttccacagcctcccatgcaccaaaat
tctccttctccggtacctagccgaaccccaacacctcaccacacgcccccaggcttggga
tcacagcaacagcaggcggcagcagctgctgccaccactgcccccacacctgctcctcag
gcaatgccacctggaccacagtcccaaactatgcacccccctcaaaggcagactccaacg
cctccgcagacgcagctgcctccgcaagtccagcctccggttccagttaccccttctgca
gagcagcagcagcagcccttgtcacagcagagcacgactgcatctgttcccacaccaaca
gcaccgctgcaacctcagcaccccacaacacctctttcacagccagctgtgagcattgat
gggcaggtatccaaccccccatccaccagcagcacagaggtgaactctcagcaaactgtt
ccagaacagcagcagccacccttgcaggaagtgaaaatggagattaaaacagaagaaggg
gaaccagaacaaacagagatgcaaatggaggagaaatctgagactaaagtagaaccagtc
gtggaggagtgtaagccagacccaatggagcaagaggagaagaaacctgaaatgaagact
gaagtaccagagggggaagaaagacctactactccagcaactcagtcttctccagcagct
gggcagtctaagaaaaaaattttcaagccagaagagttgcggcaggcgcttatgccaaca
ctggaggcactttaccgtcaggatccagagtctcttccatttcgacagcctgtggacccc
cagctactaggaattcctgattattttgacatagtaaagaaccccatggatctttctact
atcaagagaaagctggacacaggacagtatcaggagccatggcagtatgtggatgacatc
tggctcatgttcaataatgcctggttgtataaccgcaaaacatcccgggtgtacaagtac
tgttccaaactggcagaggtgtttgagcaagaaattgacccagttatgcagagccttggt
tattgctgtggaagaaagttggagttctcgccacagactttgtgttgctatggcaaacag
ctatgcacgatccctcgagatgccacttactacagttaccagaacaggtatcatttctgt
gagaagtgcttcaacgaaatccaaggggagagcgtttctctgggagatgacccatcacaa
cctcaaaccacaataaacaaagaacagttttcaaaaaggaaaaatgatacactggatccc
gagctatttgttgaatgtatagagtgtggaagaaaaatgcaccagatctgtgttcttcat
aatgaaataatctggccttctggtttcgtctgtgatggctgcctaaagaaaacaggacga
accaggaaagagaacaaattctctgctaaaaggttaccagctacaagacttggtaccttc
ctggagaacagagtcaatgatttcctaagacgacagaatcatcccgaggcaggagaggtc
acagttagggtggtacatgcatccgacaaaactgttgaagtaaaaccaggaatgaaagca
aggtttgtagacagtggagagatggcggagtctttcccttaccgaacaaaagcacttttt
gcctttgaggagattgatggtgtagacctgtgcttctttggtatgcatgtgcaggaatat
ggctcagactgccctccacccaatcaaaggcgagtgtatatatcttaccttgacagtgtt
catttcttccgacctaaatgcttgaggactgctgtctatcatgaaatactaattggatat
ctagaatatgttaagaaactagggtatactactggacacatctgggcgtgcccgcccagt
gaaggagatgactacatcttccactgccatcctcctgaccaaaagatacctaaacccaag
cgactgcaagagtggtacaaaaagatgctggacaagtctgtgtcggagcgcatcgtccat
gattacaaggatatatttaagcaggcaacagaagatcgtctaacaagtgcaaaggagctc
ccttactttgaaggggacttctggcctaatgttctggaggagagtattaaggaactagag
caagaggaagaagaacggaagagagaagaaaacactagtaatgaaagcactgatgtgagc
aagggagacagcaaaaatgccaaaaagaagaacaataagaagacaagcaaaaacaagagc
agcttgagtcgtggcaataagaagaagcctggcatgcccaatgtgtccaatgacctctcc
caaaagctgtatgccactatggagaagcacaaggaggtcttctttgtcatccgtctcatt
gctggccctgcagccaactccctgccccccatcattgagcctgacccgctcattccatgt
gacctgatggacgggcgtgatgccttcctaacccttgctagagacaagcacctggagttc
tcctcactacgaagggctcagtggtcaaccatgtgcatgctggtggaactgcatacccag
agccaagaccgctttgtttacacctgcaacgagtgcaagcatcatgtggagaccagatgg
cattgcactgtctgtgaggattatgacctgtgcatcacctgctataacactaaaaaccac
gaccacaagatggagaaattaggccttggtctagatgatgagagcaacaaccagcagacc
gccacgacgcagagccccggcgattcccggcgcctgagcatccagcgctgtatccagtct
ctggtccacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgtcagaagatg
aaacgggttgtccaacacaccaaaggctgcaaacgcaagaccaacggagggtgccccatc
tgcaagcaactcattgctctctgctgctaccacgcaaagcactgccaggagaacaagtgc
cctgtgcccttctgcctcaacatcaaacacaagctccgtcagcagcagctccagcaccgc
ctgcagcaggcgcagatgctgcgaaggaggatggcgagcatgcagcgcacgggtgtggcg
ggccagcagcaaggattgccctcgccgacgccggccacgccgacgactccgacaggccag
cagcccccgacaccgcaaaccccacagccccagcctccgccccagcctgtgtcacagcct
cagcctgcacctcccaacagcatgccaccctacaccatgccaagaactcagccccccagc
gctgtgtcccagggcaaggcaggtggccaggtgacgcctccaactccgcctcagccaccg
cagccgccagttcagggccctcctccggcagcagtagaaatggccatgcagatccagcgg
gcagcagagacccagcgccagatggcacaggttcagatcttccaaaggccgattcagcac
cagatgccccagatgccaccgatgggaatgaaccctccacagataggcagaggtcccggt
ggccatatagatcaaggaatggggccagcaggaattcagcagcagccaccgtgggtgcag
ggggccttaccccaagctcagctgcagccaggaatgcagaggccatccatgatgtcagta
gctcagccgggtcagccgatgaatatggcccctcagccagggatgggtcaagtacctggc
gctgctcagtccaaacaaccacctctgccccaggcggccttacaaaacctactgcggact
ctcaggtctcccagctcacccatgcagcagcagcaggtgcttaacatccttcactccaac
cctcagctgctggccgctttcatcaagcagcgggcggccaagtacgcggggtcccagaac
ccgcagggcatggcggggcagcctggcctcccgcaggggcagccggggctccagccgcag
caggccatgcaagggcagcaggcaggggtgcaccccaatgcagccatgcagaacatgaac
cccatgcaggcaggagtgcagaggcccagcatgccccagcagcagccgcagcagcagccg
cagcaggccatggctgggatgaatcctcaggcgcagcagatgaatatgaatcactcgggg
atggctccccagttccgagatctcctgatgagacggcaccagatgatggagcagcagcgc
caccagcagcagcagcagcagggagcgggaccggcgctggggccagggatggccaaccac
aaccagtttcagcagccccagggtgtcgggtatccccagcagcagcagcagcggatgcag
catcacatgcagcagatgcagcaaggaaacatgggacaaataagccagcttccacaggcc
atgagtgcagagacaggagccagtttgcaacaggccttccagcaaaggctgcttcagcag
cagatggggtccccagctcagcccaatcctatgagcccccaacagcacatgctccccaat
caggcccagtccccgcacctccagggccagcagctcccttcatcgctcaccaatcaagtg
cgttctccgcagcctgtaccctcaccgcggccccagtcccagccccctcattccagccca
tcccctcggatgcagcctcagccttctccgcaccacgtctccccgcagaccagctcccca
catccaggactggtagctgcccaggctaaccccatggatcaagggcactttgccagcccg
gaccagagtgcaatgctttcccagcttgctagcaatcccggcatggcaggcctccatggt
acaagcgccacggaactggggctcagctccgagaactcagacttgaattcaaacctttca
cagagtacactagacatacactag

DBGET integrated database retrieval system