KEGG   Ficedula albicollis (collared flycatcher): 101810825Help
Entry
101810825         CDS       T02815                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    101810825 (DBH)
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     101810825 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 683 aa AA seqDB search
MQNSSSKPCSCPSLKLREVASMYFTLVAAFLVILVVALQGSAPRGSDFPYKVPLDPQGLL
ELSWNVSYPEQAVHFQLLIRELQFGLLFGMSDRGEFENADLAVLWSDGHNSYFGDAWSDA
KGQLHMDSQQDYQLLGARRAPEGLYLLFRRAFSTCDPKDYLIEDGTVHLIYGILEKPVHS
LQAINVSALHGGLQRVQLLKPNISIPELPRDMKTMEITAPDVVIPSQETTYWCYMAELPE
GFPKHHIIMYEPVVTAGNEALVHHMEVFQCAAEFDSFPHYSGPCDSKMKPDRLNYCRHVL
AAWAMGAQAFYYPEEAGLAFGGPGSSRYLRLEIHYHNPLVFKGRRDSSGIRLYYTATLRP
YDAGIMELGLVYTPVMAIPPGEDSFILTGYCTDKCTQLALPAAGIRIFASQLHTHLAGRK
VVTVLSRDGREQRVVNADGHYSPHFQEIRMLKEVVAVFPGDELITTCTYNTEDRSRATVG
GFGILEEMCVNYVHYYPQTQLELCKSAVDPGYLHRYFNLVNRFNDEEICMCPQVSVPQQF
YSIPWNTFNRDVLKSLYGFAPISVHCNKSSAVRFPFSDPKSDDFWKELSAVNYPAKSQGN
TCEQQRGWCRPQVPLHPQGLAVNALRSDFHLRALKTTTVKTLHMPLISPKAGSGFGMYQQ
GRRCSRWAQGWSRALEQEHPEDV
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcagaactccagcagcaagccctgctcctgccccagcctcaagctgagggaggtggca
tccatgtacttcaccctggtggccgccttcctggtcatcctggtggtggccctgcagggc
tcggcgccccgagggagtgatttcccctacaaggtgcccctggatccccaggggctgctg
gagctctcctggaatgtcagctaccccgagcaagctgtgcacttccagctgctcatccgg
gagctgcagttcgggctcctcttcggcatgtcggacaggggcgagtttgagaacgccgac
ctggccgtgctctggagcgatgggcacaactcctactttggggatgcctggagcgatgcc
aaggggcagctccacatggattcccagcaggactaccagctcctcggggctcgcagggct
cctgaggggctctacctcctcttcagaagagccttcagcacctgtgaccccaaggactac
ctgatagaggacggcaccgtgcacctgatctacggcatcctggagaaacccgtgcactcc
ctgcaggccatcaacgtctctgccctccacggggggctgcagagggtgcagctgctgaaa
cccaacatcagcatccccgagctgcccagggacatgaagaccatggagataacagcccca
gatgttgtcattcccagccaggagacgacctactggtgttacatggcagaactgccagag
ggcttccccaaacaccacattatcatgtacgagccggtggtcacagcaggaaacgaggct
cttgtgcaccacatggaggttttccagtgtgcagctgagttcgacagcttcccccactac
agcgggccctgcgactccaaaatgaagccagacaggctcaactactgcaggcacgtgctg
gcagcctgggccatgggggcacaggctttctattaccctgaagaagcaggtctagccttt
ggtggcccaggctcctccagatatttgcgtctggagatccattaccacaatcccctggtg
ttcaaaggtcgccgggactcctcagggatccggctgtactacacggccacccttcgtccc
tacgatgctgggatcatggagctgggcttggtgtacaccccagtgatggccattccccct
ggagaggacagcttcatcctcacgggatactgcactgataaatgcacccagctggctctg
cccgctgctggcatccgcatcttcgcctcccagctgcacacacacctggcggggaggaag
gtggtgacggtgctgtcccgggacgggagggagcagcgggttgtgaacgctgacgggcac
tacagccctcacttccaggagatccgcatgctcaaggaggtggtcgcggtttttccgggc
gatgaactcatcaccacctgcacgtacaacaccgaggatcggagcagagccaccgtggga
gggtttggcatcctggaggagatgtgtgtcaactacgtgcactactacccccagacccag
ctggagctgtgcaaaagtgctgtggatcccggctacctgcaccgctacttcaacctcgtg
aacaggtttaacgacgaggagatctgcatgtgcccccaggtctctgtcccacagcagttt
tactccatcccctggaacaccttcaacagggacgtgctgaaatctctctacggctttgct
cccatctccgtgcactgcaacaaatcctctgctgtccgcttcccgttcagtgatcccaaa
tctgatgatttctggaaggaactgagtgctgttaattatccagccaaatctcaaggtaac
acttgtgagcagcagcggggatggtgccgtccccaagttcccctgcacccgcaagggctc
gcagtaaacgctctccgctcagatttccacttgagagcattgaaaacaacgactgtcaag
acactccacatgcctttgatctctccaaaagcaggctctgggttcgggatgtatcagcag
ggcagacgctgcagcagatgggctcagggctggagccgagccctggagcaggagcaccct
gaggatgtttaa

DBGET integrated database retrieval system