KEGG   Ficedula albicollis (collared flycatcher): 101810825Help
Entry
101810825         CDS       T02815                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:fab00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 683 aa AA seqDB search
MQNSSSKPCSCPSLKLREVASMYFTLVAAFLVILVVALQGSAPRGSDFPYKVPLDPQGLL
ELSWNVSYPEQAVHFQLLIRELQFGLLFGMSDRGEFENADLAVLWSDGHNSYFGDAWSDA
KGQLHMDSQQDYQLLGARRAPEGLYLLFRRAFSTCDPKDYLIEDGTVHLIYGILEKPVHS
LQAINVSALHGGLQRVQLLKPNISIPELPRDMKTMEITAPDVVIPSQETTYWCYMAELPE
GFPKHHIIMYEPVVTAGNEALVHHMEVFQCAAEFDSFPHYSGPCDSKMKPDRLNYCRHVL
AAWAMGAQAFYYPEEAGLAFGGPGSSRYLRLEIHYHNPLVFKGRRDSSGIRLYYTATLRP
YDAGIMELGLVYTPVMAIPPGEDSFILTGYCTDKCTQLALPAAGIRIFASQLHTHLAGRK
VVTVLSRDGREQRVVNADGHYSPHFQEIRMLKEVVAVFPGDELITTCTYNTEDRSRATVG
GFGILEEMCVNYVHYYPQTQLELCKSAVDPGYLHRYFNLVNRFNDEEICMCPQVSVPQQF
YSIPWNTFNRDVLKSLYGFAPISVHCNKSSAVRFPFSDPKSDDFWKELSAVNYPAKSQGN
TCEQQRGWCRPQVPLHPQGLAVNALRSDFHLRALKTTTVKTLHMPLISPKAGSGFGMYQQ
GRRCSRWAQGWSRALEQEHPEDV
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcagaactccagcagcaagccctgctcctgccccagcctcaagctgagggaggtggca
tccatgtacttcaccctggtggccgccttcctggtcatcctggtggtggccctgcagggc
tcggcgccccgagggagtgatttcccctacaaggtgcccctggatccccaggggctgctg
gagctctcctggaatgtcagctaccccgagcaagctgtgcacttccagctgctcatccgg
gagctgcagttcgggctcctcttcggcatgtcggacaggggcgagtttgagaacgccgac
ctggccgtgctctggagcgatgggcacaactcctactttggggatgcctggagcgatgcc
aaggggcagctccacatggattcccagcaggactaccagctcctcggggctcgcagggct
cctgaggggctctacctcctcttcagaagagccttcagcacctgtgaccccaaggactac
ctgatagaggacggcaccgtgcacctgatctacggcatcctggagaaacccgtgcactcc
ctgcaggccatcaacgtctctgccctccacggggggctgcagagggtgcagctgctgaaa
cccaacatcagcatccccgagctgcccagggacatgaagaccatggagataacagcccca
gatgttgtcattcccagccaggagacgacctactggtgttacatggcagaactgccagag
ggcttccccaaacaccacattatcatgtacgagccggtggtcacagcaggaaacgaggct
cttgtgcaccacatggaggttttccagtgtgcagctgagttcgacagcttcccccactac
agcgggccctgcgactccaaaatgaagccagacaggctcaactactgcaggcacgtgctg
gcagcctgggccatgggggcacaggctttctattaccctgaagaagcaggtctagccttt
ggtggcccaggctcctccagatatttgcgtctggagatccattaccacaatcccctggtg
ttcaaaggtcgccgggactcctcagggatccggctgtactacacggccacccttcgtccc
tacgatgctgggatcatggagctgggcttggtgtacaccccagtgatggccattccccct
ggagaggacagcttcatcctcacgggatactgcactgataaatgcacccagctggctctg
cccgctgctggcatccgcatcttcgcctcccagctgcacacacacctggcggggaggaag
gtggtgacggtgctgtcccgggacgggagggagcagcgggttgtgaacgctgacgggcac
tacagccctcacttccaggagatccgcatgctcaaggaggtggtcgcggtttttccgggc
gatgaactcatcaccacctgcacgtacaacaccgaggatcggagcagagccaccgtggga
gggtttggcatcctggaggagatgtgtgtcaactacgtgcactactacccccagacccag
ctggagctgtgcaaaagtgctgtggatcccggctacctgcaccgctacttcaacctcgtg
aacaggtttaacgacgaggagatctgcatgtgcccccaggtctctgtcccacagcagttt
tactccatcccctggaacaccttcaacagggacgtgctgaaatctctctacggctttgct
cccatctccgtgcactgcaacaaatcctctgctgtccgcttcccgttcagtgatcccaaa
tctgatgatttctggaaggaactgagtgctgttaattatccagccaaatctcaaggtaac
acttgtgagcagcagcggggatggtgccgtccccaagttcccctgcacccgcaagggctc
gcagtaaacgctctccgctcagatttccacttgagagcattgaaaacaacgactgtcaag
acactccacatgcctttgatctctccaaaagcaggctctgggttcgggatgtatcagcag
ggcagacgctgcagcagatgggctcagggctggagccgagccctggagcaggagcaccct
gaggatgtttaa

DBGET integrated database retrieval system