KEGG   Ficedula albicollis (collared flycatcher): 101811117Help
Entry
101811117         CDS       T02815                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Inositol phosphate metabolism
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101811117 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    101811117 (PIK3CG)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101811117 (PIK3CG)
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101811117 (PIK3CG)
Membrane trafficking [BR:fab04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101811117 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1A
AA seq 1127 aa AA seqDB search
MPDPLRKLLERGTKQCEISSGMELRDHEQPVVMREENKRRRRRMKPHCTSSSFSSMELIP
IEFILPTSNKHTKAPEIMLLEIAGNCTVEQMKAQIWMRAIEMSQTTDFYHAFTPDQFILQ
YQKKGQWYEIYDKHQVLQTLDCILYWKVLQKKVGKIYVVQKQKPSEEVQEFQRQLNDLIG
YDVTDVSNVHDDELEFTRRRLVTPRMIEVACRDPKLYAMHPWTTSKPLPEYLFKKITNNN
IFIIIHRGTTSQKIKVSIDDTPDMILHSFFTKMAKKKSLMDIPEDHSELDFVLRICGRDE
YITGETPIKDFHWIRQCLKNGEEIHLVLDNPPDPNEDEVQKEEWPLVDDCTGVTGYHEQL
TIDGKDHERVFTISLWDCNRKFRVKIIGIDIPVLPRNTDLTVFVEANIQHGQQLLSQRRT
SSKPFTEEVLWNIWLEFDIKIKDLPKGALLNLQIYCGKAQGPSAKTNLQSHEYSNSDAKC
KTQLLYYVNLLLIDHRFLLRSGDYVLHMWKIPGKGEEQGSINADKLTSATNPDKENSMAI
SIVLDKYCHPIALPKHRISSDPQGDRTRAEMPNQLRKQLEEIIATDPLNPLSPEDKELLW
HFRYESIKHPKAYPKLLSSVKWGQQEIVAKTYQLLAKKEAWDQSTLDVGLTMQLLDCNFS
DENVRAMAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLF
WFLRSEIAQSMHYQQRFAVILEAYLRGCGKAMLHDFMKQVQVIELLHKVTMEIKSVSAEK
YDVTSQVIAQLRQKLEKLQGSKLPESFRVPYDPGLRAGALVIEKCKVMASKKKPLWLEFK
CADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWEAESLDLCLLPYGCISTGNKI
GMIEIVKDATTIAKIQQSTVGNTGAFKDEILNQWLKERCMIEEKFQEAVERFVYSCAGYC
VATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLYVMG
TSGKKTSLHFHKFQDVCVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALT
VGKSEEDAKKHFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGVEKHSA
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atgccagacccgctgaggaagttgttggaacgtggaacgaaacaatgcgaaatttcttct
ggcatggagttgagggatcatgaacagcctgttgttatgagagaggaaaacaaacgaagg
agaagaagaatgaaacctcattgtacatcgagtagtttttcttcaatggaactgataccc
attgagttcattttacctacaagcaataaacatacgaaagcaccagaaattatgttactc
gaaattgctggtaactgtacagttgagcaaatgaaggcacagatttggatgcgtgcaatc
gagatgagtcaaaccacagacttctaccatgcattcaccccagatcagtttattctgcag
tatcagaagaaagggcaatggtatgaaatttatgataaacatcaagtgttacagacattg
gactgcatactgtactggaaggtgttacagaaaaaggtaggcaagatctatgttgtccag
aaacaaaaaccctcagaagaagtccaggaatttcagcggcagcttaatgatttaattggt
tatgatgtcactgatgtaagcaatgtacatgatgatgaactagaatttactcggcgcaga
ttagtcactccacgaatgatagaggtagcctgcagagatcctaaattatatgcaatgcac
ccatggactacctctaaaccactcccagaatatttatttaaaaagatcactaataataac
attttcataattatacataggggaacaactagtcagaaaattaaagtgtcaatagatgac
actccagatatgattctccacagctttttcacaaaaatggcaaagaaaaagtccttgatg
gacattcctgaagaccacagtgaactggattttgttctcaggatttgtggcagagatgag
tacattactggagagacaccaatcaaagattttcactggataagacagtgccttaagaat
ggggaagaaatccaccttgtccttgacaatcccccagacccaaatgaagatgaggttcag
aaggaagaatggcccttggtggatgactgtacaggagttacagggtatcatgaacaattg
acaatagatggaaaagatcatgagagagtcttcactatatctttgtgggattgtaatagg
aaatttagagtgaaaataattggcatcgatatcccagttttaccaagaaatactgatctt
actgtgtttgtggaggctaatattcaacatgggcagcagctcctttcacagagaagaact
tcatcaaagccttttactgaggaggttctgtggaatatttggttggagtttgatatcaaa
atcaaggatttgcctaaaggagcacttctgaatcttcagatctactgcggcaaagcacag
ggaccatctgcaaagacaaaccttcagtcacatgaatactccaactctgatgcaaagtgc
aaaacccagcttctctattatgtaaatcttttgttgatagatcaccgtttcttgctacga
agtggggactatgtgctccacatgtggaaaattccaggtaagggggaagaacaaggaagt
ataaatgcagacaaactcacatcagcaactaaccctgacaaagaaaactcaatggctatc
tctattgtgctggacaaatattgtcacccaattgccttgcccaagcacaggatatcatca
gacccccaaggggacaggacccgagctgaaatgcccaaccagcttcgcaagcaacttgag
gagatcatagcaactgacccacttaatccactttctcctgaggacaaagaactgttgtgg
cactttagatacgagagcataaagcaccccaaggcatatcctaagctgcttagctctgtg
aaatggggacaacaagaaatagtggccaaaacataccagttgctagctaaaaaagaggct
tgggatcagagcactttagatgttggactcacaatgcaacttctggactgtaacttttca
gatgaaaatgtccgagcaatggcagttcaaaaactggaaagtttagaagatgatgatgtt
cttcattatcttttacagcttgtgcaggccgtgaaatttgagccatatcatgacagcgca
ttagccagatttttgctgaaacgtggtttgagaaacaaaagaattggtcacttcttgttt
tggttcttaagaagcgaaattgcccagtccatgcactaccagcagaggtttgcagtcatc
ctcgaagcctaccttaggggctgtggaaaagcaatgctgcacgatttcatgaagcaggtt
caagtaattgaattgctgcataaagtcacaatggagattaaatcagtttctgcagaaaag
tatgatgttacttctcaagttattgcacagctgagacaaaagcttgaaaaattacagggc
agcaaacttccagaaagttttagagttccatatgatcctgggctaagagcaggagcacta
gtgatagaaaaatgtaaagtaatggcatctaagaagaagcccctctggcttgaatttaaa
tgtgcagatccaacagctctgtcaaatgaaaccataggcatcatcttcaaacatggagat
gacctccgtcaggacatgctaattttacagattcttcgaattatggaatctatttgggaa
gcagaatccttggacctctgtttgttgccatatggttgcatttctacagggaacaaaata
ggaatgattgaaattgtgaaagatgctacaacaattgccaaaattcaacagagtacagtt
gggaacactggtgcatttaaggatgaaatactaaaccagtggctcaaggaaagatgcatg
attgaagagaagtttcaggaagctgtggaaagatttgtttattcttgtgctggatactgt
gtggcaacctttgtacttggaataggagacaggcacaatgacaacatcatgattacagaa
acaggtaaccttttccatattgactttggccatattcttgggaattataaaagctttctt
ggaattaataaggagagagttcctttcgtgctgactccagattttctgtatgtcatggga
acttccggaaagaagacaagtctccatttccataaatttcaggatgtatgtgtgaaggct
tatttagctctccgacaccacacaaacctgctgatcatcctgttctccatgatgctaatg
actggaatgccccaattaaccagcaaagaagatattgaatatatcagggatgcactgaca
gtagggaaaagtgaagaagatgccaaaaagcattttcttgatcagatagaggtttgcaga
gataagggctggacggttcagtttaactggtttttgcatcttgtgcttggaatcaaacaa
ggagtagaaaagcattctgcttaa

DBGET integrated database retrieval system