KEGG   Ficedula albicollis (collared flycatcher): 101811150Help
Entry
101811150         CDS       T02815                                 

Gene name
HAT1
Definition
histone acetyltransferase 1
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101811150 (HAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 413 aa AA seqDB search
MRVKTDRGLTAMEKKLAEYKCNTNEAIQLKLVRFPEDLEDENTTFNPEYSHQVFGDDEVA
FGYKGLKILLYYIAGNLSTLFRIEYASKVNEKFDCVEADDVESKIREIIPPGFCTNTDDF
VSLLEKEVNFKPFGMLLHTYSIHNEEAGEDITYQIYKADMTCPGFREYHERLQTFLMWFI
ETASFIDVDDERWNYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILPP
FQGEGHGAQLLETVHRYYMSSPTVLDITAEDPSENYVKLRDFVLVKLCQDLLCFSPVKLM
QGFSQEMVTEAQQKLKINKQHTRRVYEILRLRATNMGDAEQSRSYRLDVKRRLIGPYKKK
QRELAKMRRCLRPEEMTNQLNQIDLNLQREQLEESFQQLVSDYRRVLERLAQA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgaagacggaccgcggacttactgctatggagaagaagctggctgaatacaag
tgtaatacaaatgaagcaattcagctgaagctagttcgctttcctgaggatttggaggat
gagaacacaacatttaatccggagtacagccatcaagtgtttggagatgatgaagttgct
tttggctacaagggacttaagatcctcttgtattacattgctggaaacctgtcaacgctc
ttccgcattgaatacgcatcaaaagtaaatgaaaagtttgactgtgtggaggcagatgat
gttgaaagtaaaattagagaaatcattccgcctggtttttgcacaaacacagatgacttt
gtgtctctgctggagaaggaggtcaacttcaagccctttggaatgctgctacatacatat
tctatccataatgaggaagctggtgaagatataacatatcagatatacaaggctgacatg
acatgtccaggctttcgagaatatcatgaaaggcttcagacgttcttgatgtggtttatt
gaaactgctagctttattgatgtagatgatgaaagatggaactactttctagtatttgag
aagtataataaggatggagctacgctctttgcgaccgtaggctacatgacagtctataat
tactatgtgtacccagacaaaacccggccacgtgtaagccagatgctgatcttgccacca
ttccaaggagaaggccatggtgctcagctgcttgaaacagttcatagatactatatgtct
tctcctacagtacttgatataacagctgaagatccatctgagaactatgtgaagcttaga
gactttgttcttgtaaagctctgtcaagatttgctttgcttttccccagtgaagttaatg
caaggtttcagtcaagaaatggtgacagaagctcaacaaaaattgaaaataaataagcaa
cacacaagacgagtttatgaaattctccgattgcgtgcaacaaatatgggcgatgcagaa
cagtccagaagctatcggttggatgttaaaagaagactgattgggccctataagaaaaaa
cagagagaacttgccaagatgagaaggtgtctaagaccagaggagatgactaatcagttg
aaccaaatagacctaaacttgcaacgtgaacagttagaagagagcttccaacagcttgtt
tcagattaccgaagagtcctagaacgacttgcacaagcatga

DBGET integrated database retrieval system