KEGG   Ficedula albicollis (collared flycatcher): 101811649Help
Entry
101811649         CDS       T02815                                 

Gene name
KAT6B
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101811649 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 2024 aa AA seqDB search
MVKLANPLYTEWILEAIQKVKKQKQRPSEERICHAVCASHGLDKKTVSEQLELSVQDGSI
LKVTNKGLASYKDPDNPGRFSCVKPGTIPKSVKGSRGACNELRNVDWNKLLRRAIEGLQE
PNGSSLKNIEKYLRSQNDLASIFNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLE
SKGAPKYSSTFPASLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIRRRYAKPIGRPKNKLKQRMLSVTSDE
GSVNAFTGRGSPGRGQKTKVCTTPSSGHAASVKDSSSRLPVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSLVLA
TGTTQKLKPPPSSLLPPIPVSGQSPSSQKSSTLTTSNSPQSSSSQSSIPSFSSLPSSSQL
KGLFDGLSHIYATQEQSRKKGHPSCAPHKRLCSKPELSSTSTSDSYFCGKKDVRSRFMSH
VCASGWGVSRGHAFKAIAHLKRTAFFKKSRILGRLKYKMTPQMGTPSPGKGSLTDGRIKP
DQDDDTEIKLSIKQENTDVFLLGSKDTVTQEDLEVFKQARELSLEKIGCKNTGETSGRYP
SVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSEKCGWFHPPANE
IYRRNDLSVFEVDGNVSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLV
GYFSKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRL
SYLAYWKSVILEYLNCHHEKQISIKGMSRATGMCPHDIATTLQQHSMIDKREDRFVIIRR
EKLISSHMEKLKANPRINEVDPESLRWTPLLVSNAAVSEEEREAEKEAERLMEQASCWEK
EEQEIFSTRTNSRQSPAKVQSKNKYLRSPESVAVVGERGQSTEQSKESSEEDGGDENQRS
SPPRLTKPQSLAMKRKRPFILKKKRGRKRRRINSSVTTETISETTEVLNEPFDNSDEERP
MPQLEPTCEMDGEDDDLKPVIRKAFEYQPGQQKQEEEEQNKEEKDINCYRSDENCTDNTE
DVAVLEESTKDNLEPLKSKQGWPKGVKRGPSKWRQSKERKPGFKLNLYTPPETPMEPDYQ
VLVEEQKEVAEDKPCSVPAVAEEPIREPVEALPPPDDEVKEVEPESLHPPSEPFEKEEND
TVKAGEEERSIEEGGITSKDQEKDKAEEVFVHKEESLHLDDQEEEEEEDEEPSHNEDHDA
DDEDDSHMGSTEAEKEELPGEAFKEMLETQQSFLDVNVQTGNSNQEELMDCGVDLAADEC
ESEQKELTTDSDPVPESDDDHTDNNQDQKAGEELHSDFKGESTETMEIDSETVQAVQSLT
QETSEHEDTFQDCAETQEACRSLQNYAHNDQSPQMTTLDDCQQSDHSSPVSSVHSHPSQS
VRSVSSPNVAPLENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDL
GSIESTTENYENPSSYDSTMGSSICGNNSSQNSCSYSSLTSSNLTQSSCAVTQQMSNING
SCSMMQQANINSPPTCNVKSPQGCVVERPPSSNQQLSQCSMAANFTPPMQLTEIPETSNA
NIGLYERMGQSEFGAGHYSQPSATFSLAKLQQLTNTLMDHSLPYSHSAAVTSYANSASLS
APLSNTGLVQLSQSPHAVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMTSSNIGISHT
QRLQTQMASKGHVSVRTKSTPLPPAAAAHQPQIYGRASQTVAMQGPARTLTMQRGMNMSV
NLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMG
TQPYAQQPMQTAPHSNMMYTPPGHHGYMNTGMSKQSLNGSYMRR
NT seq 6075 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgccaaccctctttatacggagtggattctggaagctatacaaaaagtt
aaaaagcaaaagcaaaggccttctgaagaaagaatatgtcacgctgtttgtgcttcccat
ggattagataagaagactgtttcagagcagttggaacttagtgttcaagatggttctatt
cttaaagtcactaacaaaggtcttgcatcctacaaggacccagataatcctggacggttt
tcatgtgttaaacctggcactattcctaaatctgttaagggatctagaggagcttgtaat
gagcttcgtaatgtggattggaataaactcttgagaagagcaattgaagggcttcaagaa
cctaatggctcctccctgaaaaacatagagaagtatttgagaagtcaaaatgacctagca
agtattttcaacaatcctgcctttcagcagaggttgcggctgggggccaaacgtgctgtg
aacaatgggaggttactgaaggatggtcctcagtatagagtgaattatggcagtttggaa
agcaaaggagctccaaaatactccagcaccttcccagcttcccttccacctgtcagccta
ttaccccatgaaaaagaccagccacgagctgatcccatcccgatatgcagcttttgcttg
ggaacaaaagaatcaaatcgtgaaaaaaagccagaagagctcttgtcttgtgcagattgt
ggcagcagtggacatccatcatgtttgaaattctgtcctgagttgacaacaaatgtgaag
gccctgaggtggcagtgcattgaatgcaagacatgcagcgcctgtaggatccaaggcaaa
aatgcagataacatgcttttttgcgactcctgtgatcgagggttccacatggagtgttgt
gacccaccactgtcccgaatgccaaaagggatgtggatttgccaggtctgtagaccaaag
aagaaagggagaaagctgcttcatgagaaagctgcacaaataaggagacgatatgcaaaa
cctattggacgaccgaaaaataaattaaagcaacgcatgttgtctgtaaccagtgatgaa
ggatccgtgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgtgaaggattcaagcagcagattgcct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacata
tctgcctctacacttaaagttaacaagaaaaccaaaggtctcattgatggccttactaag
ttctttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cattatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcttgtgttggct
acaggtaccacacaaaagctaaaacctccaccttcttcacttctacccccaatccccgtc
tctggtcagagccccagttctcaaaaatccagcactttgacgacttctaactctccccag
agttcttccagtcagtcaagcataccctcctttagcagcctccctagtagcagtcagcta
aagggactctttgatggactctctcatatctatgccactcaggaacagtctcgtaaaaag
ggtcacccaagctgtgcaccccacaagcgtttgtgtagtaaaccagaattatcttccaca
tcaacatctgatagttatttctgtggaaagaaagatgttaggagtaggtttatgtctcat
gtctgtgcctctggatggggtgtgtctagaggacatgcttttaaagcaattgctcacctc
aagagaacagctttctttaaaaagtccaggattctaggcagattaaagtataaaatgacc
cctcagatggggaccccctcaccagggaaggggagcttgacagacggaaggattaaacct
gatcaggatgatgatactgaaatcaaactaagcatcaaacaagagaacacggatgtattt
ctgttgggaagcaaggacactgttacacaggaggatttggaagtgtttaagcaggcccga
gagctttccctggagaaaattgggtgtaaaaacactggtgaaacaagtgggcgataccct
tcagtgattgagtttggaaaatatgagatccagacctggtactcttcaccttacccacag
gaatatgcaagattaccaaagctttacctgtgtgaattctgtcttaaatacatgaaaagt
aaaaacattttgttaaggcactcagagaaatgtggctggtttcatcctccagccaatgaa
atctacagaagaaatgacctttcagtatttgaggttgatggaaatgtgagcaaaatttat
tgtcagaatctttgtttgttagctaagctctttctggaccacaaaaccttgtattatgat
gttgaaccattcctcttctatgtccttacaaaaaatgatgagaaaggctgccatttagtt
ggatatttctctaaggaaaagctttgccagcagaagtacaatgtctcctgcataatgatc
atgccccaataccaaaggcaaggatttggaaggtttctcattgatttcagttatttactt
tctagaagagagggtcaagcaggatcccctgagaagccattgtctgatctgggtcgtctc
tcctacttggcatattggaaaagtgtcatattggaatacctgaactgccaccatgaaaaa
caaatcagcatcaaaggaatgagccgagctactggaatgtgtccacacgatattgccaca
accctgcagcaacacagcatgatagataaaagggaagatagatttgtaattattagaagg
gaaaagctgatttcaagtcatatggaaaaactgaaagcgaatccacgtatcaatgaagta
gatcccgaaagcttgagatggactcctttgttagtttctaatgctgcagtttctgaagaa
gagagggaagcagaaaaggaggctgagcgtcttatggaacaagctagctgctgggagaag
gaagagcaagaaatattctctacaagaactaatagtaggcaatcacctgcaaaagtgcaa
tctaaaaataaatatttgcgatctccagaaagtgtggcagtggtgggggagcgagggcaa
tccacagaacaatctaaggaaagcagtgaggaggatggaggggatgagaatcaacggagt
tcgcctccccggctgacaaagccccagtccctggccatgaaaagaaagagacctttcata
ctgaagaagaaaaggggccgtaaacgcagaaggataaatagcagtgttacaacagagaca
atttctgaaacaacagaggtgttgaatgagccatttgataactcagatgaagagcgtccc
atgccacagctggaacccacctgtgagatggatggagaagatgatgacttaaagcctgtg
attagaaaagcttttgaatatcaacctgggcagcagaaacaggaggaagaagagcagaac
aaggaggagaaagatattaattgttacaggagtgatgaaaattgtacagataatacagag
gatgtagctgtgctggaagaaagcactaaagacaatcttgaacctttaaagagtaagcag
ggttggcccaaaggagttaaacgtggtccatctaaatggaggcaaagcaaagaaagaaaa
cctggctttaagcttaatttatacactccacctgagactcccatggagcctgactatcag
gtgctagtggaagaacaaaaggaagtagctgaagacaagccctgctcagttcctgctgtt
gcagaggaacctattagagaacccgttgaagcattaccaccaccagatgatgaggtgaaa
gaagtagaacctgaatctctgcatccacccagtgaaccctttgaaaaagaggaaaatgat
actgtgaaagctggggaagaagaaaggagcatagaagaaggtggaatcacttcaaaagat
caagaaaaagacaaagcagaagaagtttttgtgcacaaagaagagtcccttcatttggat
gatcaggaggaagaggaggaggaggatgaagaaccttctcacaatgaggatcatgatgca
gatgatgaagatgatagtcacatgggttcaacagaggcagagaaagaggaattgcctggt
gaagctttcaaagaaatgctggaaactcagcaatcttttttagatgtaaatgttcaaact
ggtaattctaatcaggaggagttaatggattgtggggttgaccttgcagctgatgagtgt
gaaagtgagcagaaagaacttaccacagattcagacccagtgcctgaatctgatgatgat
cacacagacaacaaccaggaccaaaaagctggagaagaattacattccgatttcaaggga
gagagtactgagaccatggagattgactccgagacagttcaggcagtacagtctctaacc
caagaaacaagtgagcatgaagatacatttcaggactgtgcagagactcaagaggcctgt
agaagtttgcagaactatgcccacaatgaccaaagtccccagatgaccacactggatgac
tgtcagcagtctgaccacagcagcccagtctcatctgtgcactctcatcccagccagtca
gttcgttctgtcagtagtccgaatgtcgctcctctagagaacagctatgctcagatcagc
ccagatcaaagtgccatttctgtgccgtctctgcagaacatggagaccagcccaatgatg
gatgttccctccgtttctgatcattcgcagcaagttgtggatagtgggtttagtgactta
ggaagtattgagagcacaacagagaactacgaaaacccgagcagttacgattctacaatg
ggcagtagtatctgtggaaacaactcttctcaaaacagttgctcgtacagcagccttaca
tctagcaacctaacacagagtagctgtgcagtcacccagcagatgtctaacattaatgga
agctgcagtatgatgcaacaagcaaacatcaattctcctcccacttgtaatgtgaaatct
ccccaaggttgtgttgttgaaaggcctccaagcagcaaccaacagttatcccagtgcagc
atggctgctaatttcacaccacctatgcagttgactgaaatccccgagactagcaatgcc
aacattggattatatgaaagaatggggcagagtgaatttggagcagggcattactcacag
ccatctgccaccttcagccttgctaaactgcaacagttaactaatacgcttatggatcat
tctttgccttacagccattcagctgctgtaacttcctatgcaaacagtgcctctttgtct
gcccccttaagtaacacagggcttgttcagctttctcagtctccacatgctgttcctgga
ggaccccaagcacaggctaccatgacccctccccccaaccttactcctcctcccatgaat
ctgccacctccccttttgcagcgtaatatgacttcatcgaatattggaatatcccacacc
caaagactgcagactcagatggccagcaaaggtcacgtctctgtaagaaccaaatccacg
cctctgccgcctgctgctgcagcccatcagccacaaatttatgggcgagcttcacagact
gtggccatgcaagggcctgcacggaccttaacaatgcagcgtggcatgaacatgagtgta
aatttgatgccagcccctgcttataatgtcaattcagtgaacatgaatatgaacaccctt
aacgctatgaatggttacagtatgtcccagccaatgatgaatagtggctatcacagtaat
catgggtatatgaatcaaaccccccagtaccctatgcagatgcagatgggaatgatggga
actcagccatatgcacagcagccaatgcagacagcaccccacagtaacatgatgtacact
cctccgggccaccacggctacatgaacacaggcatgtccaagcagtctctcaatggatcc
tacatgagaaggtag

DBGET integrated database retrieval system