KEGG   Ficedula albicollis (collared flycatcher): 101812158Help
Entry
101812158         CDS       T02815                                 

Gene name
SCD5
Definition
stearoyl-CoA desaturase 5
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101812158 (SCD5)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101812158 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101812158 (SCD5)
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101812158 (SCD5)
Lipid biosynthesis proteins [BR:fab01004]
 Desaturase
  First
   101812158 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 278 aa AA seqDB search
MGLLHLGAVYALSLVPRAHILTLLWAYFCFLLTALGVTAGAHRLWSHRSYKAKLPLRIFL
AAANSMAFQNDIYEWSRDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGR
KLDFTDLLDDPVVRFQRKYYKSSVVLMCFVIPTVVPWYLWGESLWNAYFLASILRYTISL
NVTWLVNSAAHMYGNRPYDKNINPRQNTLVTLGAIGEGFHNYHHTFPFDYSASELGLKFN
PTTWFIDFMFWLGLVTDRKQAPKEMIQARKERTGDGSA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgcacctgggcgccgtgtacgcgctgagcctggtgccgcgggcgcacatc
ctcaccctgctctgggcatatttctgtttcctgctgacggctctgggtgtgacagctggc
gcacatcgcctgtggagccaccgctcctacaaagccaagctgcctttgaggatcttcctg
gctgcagctaactccatggctttccagaacgacatctacgagtggagccgggaccaccgc
gtgcaccacaagtactcggagacggacgcggacccgcacaacgcccgccgcggcttcttc
ttctcgcacatcggctggctcttcgtgcgcaagcaccgcgacgtcatcgagaagggcagg
aagctggatttcactgacctgctggatgaccccgtcgtcaggttccagagaaagtattac
aagagctcagttgtgctgatgtgctttgtgatccccaccgtcgtgccgtggtacctgtgg
ggcgagagcctgtggaacgcctacttcctggcctccatcctgcggtacaccatctccctg
aacgtcacctggctggtcaacagcgccgcgcacatgtacggcaaccgcccctacgacaag
aacatcaaccccaggcagaacaccctggtcaccctgggagccatcggtgagggtttccac
aactaccaccacaccttcccgtttgactactcagccagtgagctgggcctgaagttcaac
cccaccacctggttcattgacttcatgttttggctggggttggtcactgaccgcaagcag
gctcccaaggagatgatccaggctcgcaaggaaaggactggggatggcagtgcctga

DBGET integrated database retrieval system