KEGG   Ficedula albicollis (collared flycatcher): 101812208Help
Entry
101812208         CDS       T02815                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101812208 (UCHL3)
Peptidases [BR:fab01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101812208 (UCHL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 194 aa AA seqDB search
MEPELLSMVPRPVCAVLLLFPITEKYETFRTEEEERIKAKGQDVKSSVYFMKQTINNACG
TIGLIHAIANNRDKMNFETNSSLKKFLEDSLSMTPEERAKYLETYEAIRVTHESSAHEGQ
TEAPSIDEKVDLHFIALVNVGGHLYELDGRKPFPINHGETSDDSFLEDAIEVCKKFMERD
PEELRFNAIALSAA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagaactgcttagcatggtgccaagacctgtatgtgcagtactacttctcttt
ccaataacagaaaagtatgaaaccttcagaacagaagaagaagagaggataaaagctaag
ggacaagatgtcaaatcatcagtgtatttcatgaagcagaccattaacaatgcttgtgga
acaattgggctaattcatgctattgcaaacaacagagataaaatgaactttgaaactaat
tcttcactgaaaaagttcctagaagattcattatctatgactcctgaagagagggccaaa
tacctagaaacttatgaagctattcgtgtcactcatgaatccagtgcccatgaaggtcag
actgaggcaccaagtatagatgaaaaagtagatcttcattttattgcattagttaatgta
ggtggtcatctctatgaattggatgggcgcaagccatttccaataaaccatggggaaacc
agcgacgattcttttttagaggatgcaatagaagtttgcaagaaattcatggaacgtgac
ccagaagaattaagatttaatgcaattgcactgtctgcagcttaa

DBGET integrated database retrieval system