KEGG   Ficedula albicollis (collared flycatcher): 101812956Help
Entry
101812956         CDS       T02815                                 

Definition
uncharacterized LOC101812956
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101812956
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101812956
    1.3.1.94  polyprenol reductase
     101812956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 503 aa AA seqDB search
MPAQKATVDVEARKRKKAGDTGKSKLRLNKKVELMLSSVRWRGYACPSRGLPASSPGDYR
GARGRLCTPRAESLSGRLPRSAGKALYTPGREPLREITEERGEGSVQPGHTAPPGALRRG
SRGPLAPQGPAAPGNGKRKGQRRGGAECGRGDVLVLAGGRLVPADHRLVPAGRCLVAAGC
RLVPGGHGLVPAGHRLVPAGRDLVGAGHGVVAAGLRLPGGAGAAAAGPSDAALRRPGDRR
AAPGPPALGGAVLPRVSRYRSRGWFTHFYVVSVLWNGFLLICLFRAEFLGESLPSWIQHM
HHALGRDSQRKDTEHFSALLVLLLLWLHSCRRLAECLWTSVFSSGVIHIVQYCFGLGYYI
AVGLTVLCQVPTNGRNGKKLSVQICWYHIIGVMMYIWASLHQHRCLAILANLRKSRSGKV
VSLSHSVPFGDWFESVSCPHYFAELLIYVSMAITLGIHNVTWWCVVMYVLFNQALAAVLC
HEFYQKNFSSYPKHRKAFIPLVF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcagaaggcaaccgtcgatgtggaagcaaggaaacgaaagaaggcgggggat
accgggaaatcgaaactcagactgaataaaaaagtggaattaatgctgagcagcgtgcgc
tggagaggctacgcctgtccaagccgtgggctgccagcctcctctccgggagattaccga
ggagcgcggggaaggctctgtacaccccgggcagagagcctctccgggagattaccgagg
agcgcggggaaggctctgtacaccccgggcagagagcctctccgggagattaccgaggag
cgcggggaaggctctgtgcagcccgggcacacagcaccgcccggcgctctccggcgcggc
tcccgcggcccgctcgcccctcagggccccgctgctcccgggaacgggaagcggaaagga
cagcgccggggcggagcggagtgcggccggggcgatgtcctggttcttgctggaggccgc
ctggtccctgctgaccaccgcctggtccctgctggccgctgtctggtcgctgctggttgc
cgtctggtccctgggggccacggcctggtccctgctggtcaccgcctggtccctgctggc
cgcgacctggtcggtgctggccacggcgtggtcgctgctggcctccgccttcctgggggc
gctggcgctgctgcagcagggccctccgacgcggcgctgcggcggcctggagatcgccga
gctgctccaggacctcctgcgctagggggggcggtgctgccgcgcgtgtcccggtaccgc
agccgcgggtggtttactcacttttatgtggtttctgtgctctggaatggttttctgctg
atctgtcttttccgagctgagttccttggagagtcactcccatcatggattcagcacatg
caccatgctcttggcagagattctcagaggaaggacacagagcacttctctgcgctcctg
gttctcttgctcctttggctgcatagctgtcgaagacttgcagaatgcctctggaccagt
gtgttttccagtggtgtcattcatatcgtgcagtattgctttggacttggttactacatt
gctgttggtttaactgtgctgtgtcaagtgcctactaatggtaggaatggaaaaaagctt
tctgtgcagatctgctggtatcacattataggagttatgatgtacatttgggcctctctt
caccagcacagatgccttgcaattctagctaatcttagaaaaagcagatcaggaaaggtc
gtaagtctgagccacagtgtaccttttggagactggttcgagagcgtttcttgccctcat
tattttgcagagctcctcatatatgtttctatggccatcacacttggaattcacaatgtc
acgtggtggtgtgtagtgatgtatgttctttttaaccaggcactggctgctgttttatgt
catgagttttatcagaaaaacttcagctcctacccaaagcatcgaaaagcatttatacca
cttgttttttag

DBGET integrated database retrieval system