KEGG   Ficedula albicollis (collared flycatcher): 101813682Help
Entry
101813682         CDS       T02815                                 

Definition
UDP-glucuronosyltransferase 2A2-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101813682
   00053 Ascorbate and aldarate metabolism
    101813682
   00500 Starch and sucrose metabolism
    101813682
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101813682
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101813682
   00860 Porphyrin and chlorophyll metabolism
    101813682
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101813682
   00982 Drug metabolism - cytochrome P450
    101813682
   00983 Drug metabolism - other enzymes
    101813682
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101813682
Glycosyltransferases [BR:fab01003]
 Others
  Hydrophobic molecule
   101813682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 533 aa AA seqDB search
MVMNTTSSKKYLQLLLFQVALLGPVFCGNILVWPTEGSHWLNMNVIIQELSHRGHSFTIL
VSNATLFIEPRPKATENFETCNVPFKKDVPENLINGVGDLWLNNRPTIFTFWRFYKDLGR
LSVGWQEMNKIMCDAVLANKDLIARLQGSGFDLLLSDPVTPYGELLALKLGIPFVYSLCF
SPAFTLERHCGKIPTPPSYTPAALSELTDRMSSGERVKNFVSYHLHDYVFQSYXGHWDIY
YSKVLGRPTTLCETMGKAEIWLIRTYWDFEFPRPFLPNFEFVGGLQCQPAKPLPKEMEEF
VQSSGEHGIIVFTLGSMVYNLSDEKSTVIAKALSQLPQKVLWRYKGKKPETLGSNTRIYD
WIPQNDLLGHPLTKAFITHGGTNGLYEAIYHGIPMVGIPMFADQHDNIAHMVAKGAAVQV
DFNTMKTQDLVDALNTVIYNSTYKENALKLSKIQHDQPVKPLDRAVFWIEFVMRHKGAKH
LRPAAHHLTWYQYHSLDVLAFLFICTATIVFILFKCCLCCCRRCGRIAKRKKE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgaacacaactagctcaaagaaatacctccagctgctcctttttcaggttgct
cttctagggcctgtcttctgtgggaacatactggtttggccaacagaaggcagccactgg
ctgaacatgaatgtaattatacaggagctcagccaccgtgggcacagctttaccatcttg
gtatccaatgctaccctcttcattgaacccaggcctaaagccacggagaattttgagacc
tgtaatgtaccattcaaaaaagatgttcctgagaacctgattaatggagtaggggatcta
tggctcaacaacaggccaaccatctttaccttctggaggttttacaaggatctgggaaga
ctgtctgtaggctggcaggagatgaacaagatcatgtgtgatgcagtgctggccaacaaa
gacctgattgctcgtctgcaggggtctggctttgacctgctgctgtcagaccctgtgacc
ccctatggagaactcctggctctcaagctgggcattccctttgtctactcgctatgtttc
tccccagccttcactctggaaaggcactgcggcaagattccaaccccaccatcctacaca
cctgcagccctatctgagctcactgaccgcatgtcttctggggagagagtaaaaaacttt
gtgtcttaccacctgcacgactacgttttccagagctactgaggacattgggatatctac
tacagcaaggtcttaggaaggcccacaaccctgtgtgagacgatgggaaaagcagagatt
tggttaatcagaacatactgggattttgaatttccacgccctttcctgcccaactttgag
tttgttggaggacttcaatgccagcctgcaaaaccattaccaaaggaaatggaagaattt
gttcagagctcaggggaacatggtatcattgtattcactcttggatcaatggtctacaac
ctgagtgatgaaaaaagtactgtgatcgccaaagccctcagccagcttccacaaaaggtc
ctctggcggtacaaagggaaaaaaccagaaactctgggctccaacaccaggatttatgac
tggataccgcagaatgacctgcttggccatcccttgacaaaggcctttattacacatggt
gggaccaatgggctctacgaagccatctaccacgggatcccaatggttgggattccaatg
tttgctgaccagcatgacaacattgctcacatggtagcaaaaggagctgcagttcaggtg
gatttcaacacaatgaagacgcaggacctggttgatgcactgaacacagtcatttacaat
tccacctataaggaaaatgctctaaagttatccaagatacagcatgaccagcctgttaag
cctctggacagagctgtcttctggattgaatttgtcatgcgtcacaaaggagcaaagcac
ttgagaccagctgctcaccatctcacctggtaccagtaccactccctggatgttctggca
ttcttattcatctgtacagccactattgtcttcattcttttcaagtgctgcctatgttgc
tgtagaagatgcggcaggatagcaaagaggaagaaagaatag

DBGET integrated database retrieval system