KEGG   Ficedula albicollis (collared flycatcher): 101813682Help
Entry
101813682         CDS       T02815                                 

Gene name
UGT2B17
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member B17
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101813682 (UGT2B17)
   00053 Ascorbate and aldarate metabolism
    101813682 (UGT2B17)
   00500 Starch and sucrose metabolism
    101813682 (UGT2B17)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101813682 (UGT2B17)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101813682 (UGT2B17)
   00860 Porphyrin and chlorophyll metabolism
    101813682 (UGT2B17)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101813682 (UGT2B17)
   00982 Drug metabolism - cytochrome P450
    101813682 (UGT2B17)
   00983 Drug metabolism - other enzymes
    101813682 (UGT2B17)
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101813682 (UGT2B17)
Glycosyltransferases [BR:fab01003]
 Others
  Hydrophobic molecule
   101813682 (UGT2B17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 744 aa AA seqDB search
MVMNTTSSKKYLQLLLFQVALLGPVFCGNILVWPTEGSHWLNMNVIIQELSHRGHSFTIL
VSNATLFIEPRPKATENFETCNVPFKKDVPENLINGVGDLWLNNRPTIFTFWRFYKDLGR
LSVGWQEMNKIMCDAVLANKDLIARLQGSGFDLLLSDPVTPYGELLALKLGIPFVYSLCF
SPAFTLERHCGKIPTPPSYTPAALSELTDRMSSGERVKNFVSYHLHDYVFQSYXGHWDIY
YSKVLADNSHWLNMEHILQELVVRGHEVTVLLPSCFLILNPTQPSPFQFEVIEVPITKKE
MADLMDEILYFFFYEERELPIWEGAYKIAQKILQMKNITKMICDGVVKNETLMERLRAST
FDVLLADPLSPSGELVAEKLGIPFVYTFRFSMGNTVERLCGTLPAPPSYVPTTLTSLTDR
MTFWQRLKNILSYTLQDFIFHYVLWASWDQYYSEVLGRPTTLCETMGKAEIWLIRTYWDF
EFPRPFLPNFEFVGGLQCQPAKPLPKEMEEFVQSSGEHGIIVFTLGSMVYNLSDEKSTVI
AKALSQLPQKVLWRYKGKKPETLGSNTRIYDWIPQNDLLGHPLTKAFITHGGTNGLYEAI
YHGIPMVGIPMFADQHDNIAHMVAKGAAVQVDFNTMKTQDLVDALNTVIYNSTYKENALK
LSKIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAAHHLTWYQYHSLDVLAFLFICTATI
VFILFKCCLCCCRRCGRIAKRKKE
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggtcatgaacacaactagctcaaagaaatacctccagctgctcctttttcaggttgct
cttctagggcctgtcttctgtgggaacatactggtttggccaacagaaggcagccactgg
ctgaacatgaatgtaattatacaggagctcagccaccgtgggcacagctttaccatcttg
gtatccaatgctaccctcttcattgaacccaggcctaaagccacggagaattttgagacc
tgtaatgtaccattcaaaaaagatgttcctgagaacctgattaatggagtaggggatcta
tggctcaacaacaggccaaccatctttaccttctggaggttttacaaggatctgggaaga
ctgtctgtaggctggcaggagatgaacaagatcatgtgtgatgcagtgctggccaacaaa
gacctgattgctcgtctgcaggggtctggctttgacctgctgctgtcagaccctgtgacc
ccctatggagaactcctggctctcaagctgggcattccctttgtctactcgctatgtttc
tccccagccttcactctggaaaggcactgcggcaagattccaaccccaccatcctacaca
cctgcagccctatctgagctcactgaccgcatgtcttctggggagagagtaaaaaacttt
gtgtcttaccacctgcacgactacgttttccagagctactgaggacattgggatatctac
tacagcaaggtcttagctgacaacagccactggctgaacatggagcacatactacaggag
cttgtggtccggggccacgaggtgactgtgctgctgccttcgtgcttcctcatcctcaat
cccacacagccctcacccttccagtttgaggtgattgaggtgccaatcaccaaaaaggag
atggctgacttaatggatgaaattttatacttttttttttatgaggagagagagctacct
atctgggaaggtgcttacaagattgctcaaaagatattgcagatgaagaacataaccaaa
atgatttgtgatggagttgtgaagaatgagaccctgatggaaagactgagggcatccacc
ttcgatgtccttttggcagacccactgtcacccagtggggagctggttgctgagaagctg
ggtatcccctttgtgtataccttccggttctctatgggcaacacagtggagcggctctgt
ggaacactcccagcacctccttcctatgtaccaaccaccctaaccagcctaacagatagg
atgaccttctggcaaaggctaaaaaacatcctcagctacactctgcaggatttcatattt
cattacgttctctgggcaagctgggatcaatactacagtgaagttttaggaaggcccaca
accctgtgtgagacgatgggaaaagcagagatttggttaatcagaacatactgggatttt
gaatttccacgccctttcctgcccaactttgagtttgttggaggacttcaatgccagcct
gcaaaaccattaccaaaggaaatggaagaatttgttcagagctcaggggaacatggtatc
attgtattcactcttggatcaatggtctacaacctgagtgatgaaaaaagtactgtgatc
gccaaagccctcagccagcttccacaaaaggtcctctggcggtacaaagggaaaaaacca
gaaactctgggctccaacaccaggatttatgactggataccgcagaatgacctgcttggc
catcccttgacaaaggcctttattacacatggtgggaccaatgggctctacgaagccatc
taccacgggatcccaatggttgggattccaatgtttgctgaccagcatgacaacattgct
cacatggtagcaaaaggagctgcagttcaggtggatttcaacacaatgaagacgcaggac
ctggttgatgcactgaacacagtcatttacaattccacctataaggaaaatgctctaaag
ttatccaagatacagcatgaccagcctgttaagcctctggacagagctgtcttctggatt
gaatttgtcatgcgtcacaaaggagcaaagcacttgagaccagctgctcaccatctcacc
tggtaccagtaccactccctggatgttctggcattcttattcatctgtacagccactatt
gtcttcattcttttcaagtgctgcctatgttgctgtagaagatgcggcaggatagcaaag
aggaagaaagaatag

DBGET integrated database retrieval system