KEGG   Ficedula albicollis (collared flycatcher): 101814000Help
Entry
101814000         CDS       T02815                                 

Gene name
GPD1
Definition
glycerol-3-phosphate dehydrogenase 1 (soluble)
Orthology
K00006  
glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:fab00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 349 aa AA seqDB search
MGGKKVCIVGSGNWGSAIAKIAGSNAARLSSFESQVNMWVLQEEVGGRRLTDIINTEHEN
VKYLPGHKLPPNVVAEPDLLKACAGADVLLFVVPHQFIGKVCDQLKGHVKKEAVGMSLIK
GVDEGPDGLRLISDIIHEKLGIEMSVLMGANIANEVAEEKFCETTIGCKNMKHGQMLKEL
MQTPNFRVSVVQDADTVEICGALKNVVAVGAGFCDGLGYGDNTKAAVIRLGLMEMIGFSK
LFCKGPVTPATFLESCGVADLITTCYGGRNRKVAEAFAKTGKSIEQLEKEMLNGQKLQGP
QTSAELHRILKSKNVVEKFPLFTAVYRICYEGKPVTDFITCLQSHPEHM
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggtggcaagaaagtttgcatcgtgggctctggcaactggggctcggccatcgccaag
atcgccggcagcaacgcagctcggctgagcagcttcgagagccaggtgaacatgtgggtg
ctgcaggaggaggtgggcggccggcggctcacggacatcatcaacacggagcacgagaat
gtcaagtacctgccggggcacaagctgccccccaacgtggtggcagagccagacctgctc
aaagcctgtgcaggtgctgatgtcctcctgttcgtggtgccccaccagttcattggcaaa
gtctgtgaccagctcaagggccacgtgaagaaagaggcggttgggatgtcgctcatcaag
ggtgtggatgaaggaccagatgggctgaggctgatctcagacatcatccatgagaaactg
ggaatagaaatgagcgtgctcatgggggccaatattgccaatgaagtggcagaagagaag
ttctgtgaaaccaccatcggctgcaagaacatgaagcacgggcagatgctgaaggagctg
atgcagacacccaacttccgtgtgtccgtggtgcaagatgctgacactgtggagatctgt
ggggctctcaagaatgtggtggctgtaggagctggtttctgtgatgggctgggctacggt
gacaacacaaaggctgctgtgatccgcctgggcctgatggagatgattggcttttccaaa
ctcttctgtaagggccctgtcacccctgccaccttcctggagagctgtggtgttgctgac
ctcatcaccacctgctacgggggccgcaaccgcaaggtggccgaggcttttgccaagact
gggaagtccatcgagcagctggagaaggagatgctgaatggacagaagctgcagggtccc
cagacatctgctgaactgcatcgaatcctcaagagcaagaatgtagtggagaagttcccc
ctcttcactgctgtgtatcgcatctgctacgagggaaaacctgtcaccgacttcatcacg
tgtctgcagagccaccctgagcacatgtaa

DBGET integrated database retrieval system