KEGG   Ficedula albicollis (collared flycatcher): 101814126Help
Entry
101814126         CDS       T02815                                 

Definition
lipoprotein lipase-like
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101814126
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101814126
Enzymes [BR:fab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     101814126
Exosome [BR:fab04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101814126
  Exosomal proteins of breast milk
   101814126
Heparan sulfate/heparin binding proteins [BR:fab00536]
 Enzymes (General comment) Variety
  101814126
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Z
AA seq 464 aa AA seqDB search
LAAGENNFEGIESKFSLRTPAEPDEDVCYLVPGQVDSLAQCNFNHTSKTFVVIHGWTVTG
MYESWVPKLVDALYKREPDSNVIVVDWLVRAQQHYPVSAGYTRLVGRDVATFIDWMEEQF
NYPLNKLHLLGYSLGAHAAGIAGNLTKKKVNRITGLDPAGPTFEYADELTRLSPDDAEFV
DVLHTYTRGSPDRSIGIQKPVGHIDIYPNGGGFQPGCNFGEALRLIAEKGLGDVDQLVKC
SHERSIHLFIDSLLNEEKPSMAYRCNTKEAFEKGLCLSCRKNRCNNLGYKVNRVRTKRNT
KMYLKTRAQMPYKVFHYQVKIHFFGKTNMTKTNQPFLISLYGTLDESQNIGFTLPEVSSN
KTFSFLIYTEVDIGDLLMLKLQWEKDTFFSWLDWWTPLTFDIQRIRVKSGETQKKVVFCS
RDGTSRLGKGEEAAIFVKCSEQPTNRKRGGSKKASKENSAHESA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
cttgcagctggtgaaaacaattttgagggaattgagagcaagttttctttacggacgcct
gcagagcccgatgaagatgtgtgctacctggttcctgggcaggtggacagcctggcacag
tgcaacttcaatcataccagtaaaacctttgtggtgatccacggatggacggtgacaggg
atgtatgaaagttgggtcccgaagctggtggatgctctgtacaagagggagcctgactca
aacgtcattgtggtggactggctagttcgagctcagcagcactatccggtgtctgccggg
tacaccaggctggtgggaagggatgttgctacctttattgactggatggaggagcagttc
aattatcctctcaacaaactccacttgctggggtacagtctaggtgcccatgctgctggt
attgctgggaacctgaccaaaaagaaggtgaacagaattactgggctggatcctgctggt
cctacctttgagtatgctgacgaactcacccgcctctccccggacgacgctgagtttgtg
gatgtcctgcacacctacacccgaggctctccagaccgcagcattgggatccagaaacct
gttggacacattgatatttatcccaacggtggaggtttccagccaggctgcaattttggg
gaagcactgcgtctgattgctgagaaagggcttggagatgtggaccagctggtgaagtgc
tcccatgaacgatccatccacctcttcattgactctctcctgaatgaagaaaagcccagc
atggcctaccgctgcaacacaaaggaggccttcgagaagggtctctgcctgagctgccgc
aagaaccgctgcaacaatctgggctacaaggtcaacagagtgagaacaaagaggaacacc
aaaatgtacctgaaaacccgagctcagatgccctataaagtctttcattaccaggtcaag
atccatttctttggaaagactaacatgaccaagacaaaccagccattcctgatatctctc
tatggtactctagatgagagtcagaacattggtttcacactgcctgaagtctcctcaaac
aagaccttctccttcctgatttacacagaagtagatattggagacctgcttatgctgaag
ctgcagtgggaaaaagacaccttcttcagctggttagactggtggactcctttgacattt
gacatccagagaatcagagtgaagtcaggagaaactcagaaaaaagtggtgttctgttct
cgagatggcacctcacgtctcggcaagggagaagaggcagcaatatttgtgaaatgctcg
gagcagcccaccaacaggaagagaggaggttccaagaaagcctcgaaagaaaattctgct
catgaatctgcttaa

DBGET integrated database retrieval system