KEGG   Ficedula albicollis (collared flycatcher): 101814521Help
Entry
101814521         CDS       T02815                                 

Definition
NADH-cytochrome b5 reductase 3-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101814521
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     101814521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1A
AA seq 301 aa AA seqDB search
MGAQLSVLRQVVTYPIWLIYTTVMRLFRNPRPAITLKDPEVKYALRLIDKEEVSHDTRRF
RFALPSMEHVLGLPLGQHIYLSARIDGALVVRPYTPVSSDDDKGFVDLVVKVYFRGVHPK
FPDGGKMSQYLDSLKIGDTIDFRGPSGLLVYKGKGKFDIRPEKKAEPVTKTVKYVGMIAG
GTGITPMLQIIRAIIKDKDDPTICQLLFANQTEKDILLRSELDEIQAQNPNRFKCWYTLD
TAPENWEYSQGFVNQEMIRDHLPPPQSDVLILMCGPPPMIQYACIPNLDKLGYAKDMRFS
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggggcacagctgagcgtgctgcgtcaggttgtgacgtacccgatatggctcatctac
accactgtcatgaggctcttcaggaatccccggcctgcaatcaccctgaaggacccagaa
gtgaagtatgcactgaggctgattgataaggaggaagttagtcacgacacaaggaggttt
cgatttgctctcccttccatggagcacgttctgggtctccctctagggcagcacatctac
ctgtctgcacggattgacggagctctggttgtcagaccttacactccagtttccagtgat
gatgacaagggctttgtggatcttgttgtcaaggtctacttcagaggtgtccatcccaag
tttcctgatggggggaagatgtctcaatacttggacagcctgaaaataggggacaccatt
gacttcaggggaccaagtggcctccttgtgtacaaaggaaaaggcaagtttgatattcgg
ccagaaaagaaagctgaaccagttaccaagacagtgaaatacgtggggatgattgcaggg
gggactgggataacacctatgctgcagatcattcgagcaatcataaaggacaaagatgac
cccaccatttgccagctgctgtttgctaatcagactgagaaggatatcctgttacgttcc
gagctcgatgagatccaggctcagaatcccaatcgcttcaagtgttggtacaccctggac
acagcacctgaaaattgggagtacagccaaggatttgtgaaccaagagatgatcagagac
cacctgcccccacctcagagtgatgttctgatcctcatgtgtggacctcctccaatgatc
cagtatgcttgcattcccaacctggacaaactgggctatgccaaggatatgaggttctcc
ttctaa

DBGET integrated database retrieval system