KEGG   Ficedula albicollis (collared flycatcher): 101815607Help
Entry
101815607         CDS       T02815                                 

Gene name
AGL
Definition
amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fab00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 1535 aa AA seqDB search
MPGGKETRLLHLAEMEKLDKTLFRLEQGFELQFRLGPTLQGKAVTVYTNYPASGEVFDRH
KFRTLSWHNPTGKEDDSDKYCKLDLQISGSYQYYFSLGNEKSGGGYIVVDPILHVGADNH
VLPLDCVTLQTYLAKCLGPFHEWEDRLKVAKETGYNMIHFTPLQKLGLSRSCYSLADQLE
VNPEFSDHNKKCTWSDIGALVEKMKNEWNMLCITDVVYNHTATNSEWLRMHPECGYNLVN
SPHLKPAWVLDRALWHLTGMVADGKCIAKGVPPVIENDHHLNCLRKIIYEDIYPKIKLWE
FFQVDVNKAVQQFKTLLTQGKGRVXKMGTKPDPNHHLQIIQDPDYRRLGCTVDMNIALAT
FIPHSNGPAAIEECCNWFRKRIEELNAEQYRQTTHHQEQAVNCLVGTVVYERIACNGPKL
GPISRKHPLVTRYFTYPFKELTVEEEETMINQPDKACYFMAHNGWVMGDDPLRNFAEPGS
NVYLRRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITAKYFHGVRLDNCHSTPIHVA
EYMLDTARKLRADLYVVAELFTGNEELDNIFVNRLGITSLIREAMTAYNSHEEGRLVYRF
GGEPVGSFVQPRLRPLMPAIAHALFMDITHDNECPIQHRSAYDALPSAMIVSMACCATGS
TKGYDELVPHQISVVSEERFYAKWNPAAHLTSGEVNFQTGILAGRLAINRLHQELGAKGF
NQVYVDQVDEDIVAVTRHCPTTHQSVVAVCRTAFRDPKTCFYSQEVPEMCIPGKIDEVVL
EARTIERSASPYKKDLHFINGLPNFTMELREHIQIKDSKIIKQAGTAIKGPNEFVQEIEF
ERLTPGSVIVFRVSLDPKAQEAVGILRNHLIQFSSHFKSGSLPDDHSAPILKTPFASIAS
KLTLAELNQVLYRCEAEEQEDGGGCYNIPNWSPLKYAGLQGLMSVMADIRPKNDLGHPFC
DNLRSGDWMIDYVSNRLISRAGACAEVGKWLKAMFVYLKRIPRYLIPCYFDAILVGAYTT
LLDVGWHQMSSFVQNGSTFVKHLSLGSIQLCGIGKYSCLPDLSPSLHDVPYRLNEITNQK
EQCCVSMAAGLPHFSSGIFRSWGRDTFIALRGLLLVTGRYLDARNIILAFGGTLRHGLIP
NLLGGGTHARYNCRDAVWWWLQCIQDYSKIVPNGLDILRCPVSRMYPRDDSSPQPAGAVD
QPLYEVIQEAMQRHMEGINFRERNAGPQIDQNMRDEGFNITAGIDHETGFVFGGNRFNCG
TWMDKMGEGDKARNKGIPATPRDGSAVEMVGLCKSAVHWLKDLSGKNIFPFRGVTVKRHG
KEEMITYDEWDRKIQVNFERLFFVSENPADPNEKHPDLVHKRGIYKDSYGASSPWCDYQL
RPNFPIAMVVAPELFTPERAWKALQIAEEKLLGPLGMKTLDPDDMVYCGVYDNALDNDNY
NISRGFNYHQGPEWVWPIGYFLRAKLYFSRLIGPEIYAKTVVMIKNVLSRHYVHLERSSW
KGLPELTNENGQYCPFSCETQAWSIGVILEVLYDL
NT seq 4608 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcggtaaggagacgcggctgctgcacctcgccgagatggagaagctggacaag
accctcttcaggctggagcagggttttgagctacaattccgattgggcccaactcttcag
ggcaaggccgttactgtgtacacaaattatccagcttctggagaagtatttgatcgccac
aagttcaggacattatcatggcacaatcccacagggaaagaagatgactctgacaaatac
tgcaagttggatctccaaatttctgggtcataccagtactattttagtcttggaaatgaa
aaaagtggtggaggttacatagttgtggatcccattttgcatgttggagctgataatcat
gtactgcctttggattgtgttacgctccagacgtacctcgctaagtgtctgggaccattt
catgaatgggaagataggcttaaagtggcaaaagaaacaggttacaacatgattcatttt
acgccactacagaagcttggattgtctagatcatgttattcattggctgaccagttagaa
gtaaatcctgaattttcagaccataataaaaagtgcacttggagcgatataggagcactt
gtggaaaaaatgaaaaatgaatggaatatgctttgcatcacagatgtagtctacaatcat
actgctactaacagtgagtggctcaggatgcatccagaatgtggctataaccttgtaaat
tctcctcacctgaagccagcttgggtcctggacagagctctgtggcatttgactggtatg
gtggctgatgggaagtgtattgccaaaggggtccctcctgtgattgaaaatgatcatcac
ttgaattgtttacgtaaaataatttatgaagatatatatccaaaaattaaattatgggaa
tttttccaagtggatgttaacaaagccgtgcagcaatttaaaacccttctaactcaaggt
aaaggaagagtatgaaaaatgggcactaaacctgatccaaatcatcatcttcaaataatt
caggaccctgattatagacgacttggctgtactgtagatatgaacatagcactggcaacg
ttcataccacacagcaatggaccagctgcaatagaagaatgttgtaattggtttcgcaag
aggattgaggaactaaatgccgagcaatacagacaaaccactcaccatcaagaacaggct
gtgaattgccttgtggggactgtggtttatgaacgaattgcttgtaatggtcccaagctg
ggacctatcagtagaaaacatcccttggttaccaggtattttacatatccattcaaagag
ctgactgtggaggaagaagaaactatgataaatcagccagataaagcttgttatttcatg
gctcataatggctgggttatgggagatgatcctcttagaaactttgcagaaccgggttca
aatgtgtacttgagaagagagctcatttgttggggagacagtgtgaaactgcgttatggt
aataaacctgaagactgcccatacctctgggcacatatgaaaaaatacactgaaatcact
gccaaatatttccatggtgttcgtctggacaactgtcactcaacacctattcatgtagct
gagtacatgctggacacagctagaaaattgcgagccgatttgtatgtagtggctgaactg
ttcacaggaaatgaggagctggacaatatctttgtgaataggctgggcattacctcctta
ataagagaggccatgactgcctacaatagccatgaagaggggaggttggtttatcgcttt
ggaggtgagcctgttggatcttttgttcagccacgtttgaggcctttgatgcctgctatt
gctcatgcactgttcatggatattacacatgataatgaatgtccgattcagcaccgatct
gcatatgatgctcttcctagtgcaatgattgtttccatggcatgctgtgctacaggaagt
accaaaggctatgatgaattagtaccacaccagatctcggtagtatctgaagagaggttt
tatgcaaagtggaatccagcagcacatctgacttctggtgaagttaatttccaaacagga
attctagcaggaaggctggccataaacaggctgcatcaggagctgggggctaaaggcttt
aatcaggtgtatgtagaccaagttgatgaagatatagttgcagtgacaagacactgccct
accacacaccagtctgttgtagctgtgtgtcgaactgccttcagggatcctaaaacctgt
ttctacagtcaagaagtacctgaaatgtgtatcccaggcaaaatagatgaagtagtactt
gaggcaaggactattgagagaagtgctagtccttacaaaaaggatctacattttataaat
ggattgcctaatttcacaatggaactcagagagcatatccagataaaagacagtaaaatc
ataaagcaagctggaactgctataaaagggccaaatgagtttgttcaagaaatagaattt
gaaagactaacaccaggaagtgtaatagtattcagagttagtctggacccaaaggcacaa
gaggctgtggggatactccgcaatcatttgatccagttcagctctcatttcaaatctgga
agtcttcctgatgatcactcagcaccaatattaaaaacaccatttgcttcaattgcatct
aaactaactttggcagaactaaatcaagtgctgtatagatgtgaggcagaagaacaggag
gatggtggaggctgttacaatataccaaactggtcgcccctaaagtatgcaggcctccaa
gggttaatgtcagtgatggcagacattaggccaaagaatgatttgggtcatccattttgt
gataatttaagatctggggactggatgattgattatgtcagtaatcgtctgatttcacgt
gctggagcctgtgcagaagttggtaaatggttgaaggccatgtttgtctacctgaaaaga
attccacgttacctcatcccatgttactttgatgccattttagtgggagcgtatactaca
cttctggatgtgggatggcatcagatgtccagctttgtgcagaatggatcaacgtttgtt
aaacacctttccttgggttcaatccagttatgtgggataggaaaatactcttgtctgcca
gatctgtctccttccttacatgatgttccctataggctgaatgaaattacaaatcagaaa
gaacaatgttgtgtttccatggcagctggtttacctcacttttcttctggaatttttcgt
tcatggggaagggatacttttattgcactaagaggtctgctgttagttactgggcgctat
ctagatgcaagaaacatcattttagcatttggtgggactttaagacatggtctcattccc
aatctgctcggcggggggacacatgccagatacaactgtcgggatgctgtgtggtggtgg
cttcagtgtatccaggactacagtaaaattgttcccaatggattagacattctcaggtgt
cctgtttctaggatgtacccaagagatgattcttctcctcagcctgctggcgctgtggat
cagccactttatgaagtaatacaggaagcaatgcaacgacatatggaaggcataaatttc
cgagaaaggaatgctggtcctcagattgatcaaaacatgagagatgaaggttttaatata
actgcaggcattgaccatgaaactggctttgtctttggagggaaccgcttcaattgtggc
acttggatggataaaatgggagagggtgacaaagctcgcaacaaaggaattccagctact
ccaagagatggctctgctgtggaaatggttggcctgtgcaagtcggctgttcattggttg
aaggatttatctgggaaaaacatatttccattccgtggagtcactgtaaaaagacatgga
aaggaggagatgatcacatatgatgagtgggacaggaaaattcaagtaaactttgaaagg
ctgttctttgtctctgagaatccagcagatcctaatgaaaaacacccagatcttgtacac
aaacgtggaatttataaggacagctatggagcttcaagtccatggtgtgattaccaactc
aggccaaattttccaatagcaatggttgtggctcctgagttgtttacacctgagagagct
tggaaagctctgcagatagcagaggaaaagcttcttggtccattaggcatgaaaacctta
gacccagatgatatggtgtactgtggagtctatgataatgctcttgacaatgacaactac
aatatatccagagggtttaattatcaccaaggacctgaatgggtgtggccaattggatat
tttcttcgtgccaaactgtatttctctaggttgattggtccagagatatatgcaaaaact
gtagttatgattaagaatgttctttctcgccactatgttcatcttgaaagatcatcctgg
aaaggcctcccagaactaaccaatgagaatgggcagtattgtccttttagctgtgaaact
caagcctggtcgattggtgttatccttgaagtcctttatgacttgtaa

DBGET integrated database retrieval system