KEGG   Ficedula albicollis (collared flycatcher): 101815725Help
Entry
101815725         CDS       T02815                                 

Gene name
ALPI
Definition
alkaline phosphatase, intestinal
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101815725 (ALPI)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101815725 (ALPI)
Exosome [BR:fab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101815725 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 530 aa AA seqDB search
MPREQISLGCGDPAGVPQGCSAGELGLMGVCTVPEEEEKPSFWNTQAAAAIEASFEIQPK
IRQAKNLILFLGDGFGIPTITATRILKGQQQDKPGPETPLALDAFPYVALSKTYNVDRQV
PDSAGTATAYLCGVKGNYQTVGLSAAARHSQCNTTAGNEVISVLERARRAGKAVGVVTST
RVQHASPSGTYAHVVNRDWYADASMPPEARQQGCKDIAWQLVHNVDINVILGGGRKYMTP
AGTPDPEYPTDRNQSGIREDGQNLIDMWLEKRPGARYVWNRTEMLAAAANSRVNYLMGLF
EPGDMKYSLVRNTTVDPSLTEMMEAAITILSRNPNGFYLFVEGGRIDHGHHDGAAHKALT
EAVEFDRAIERAGALTDEDETLTVVTADHSHVFSFGGYTLRGSSIFGLAPKTALDGKNYT
SILYGNGPGYQGPDRPDVDVDTAMDFEYLPQAAVPLDSETHGGEDVAILAKGPMAHLFHG
VQEQTYVAHVMAYAACIEPYTNCRQRDAAPGIRATPLALLLPALLLPLFH
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcccagggaacaaatatccctggggtgtggggaccctgcaggggtgccccagggatgc
agtgctggtgagctgggactgatgggtgtttgcacagtcccagaggaggaggagaaacca
tccttctggaacacacaggcagctgcagctatagaagcctccttcgaaatccagcccaag
atacgccaagccaaaaacctcatcctcttccttggggatggatttgggatccccaccatc
acagccacccgcatcctaaaggggcagcagcaggacaagccgggccctgagacccctctt
gctctggatgctttcccctacgtggcactctccaagacctacaatgtggacaggcaggtc
cctgacagcgcagggacagccacagcctatctctgtggggtgaagggcaactaccagacc
gtggggctgagcgcggccgcccgccactcgcagtgcaacaccacggccggcaacgaggtg
atctcagtgctggagcgagcccgcagagccgggaaggcggtgggcgtggtgacctcgacg
cgggtgcagcacgcctcgccctcggggacctacgcgcacgtggtgaaccgggactggtac
gcggacgccagcatgcccccggaggcgcggcagcagggctgcaaggacatcgcctggcag
ctggtccacaacgtcgacatcaacgtgatcctgggcggtggtcggaaatacatgaccccg
gcggggacgccggaccctgagtaccccaccgaccgcaatcagagtgggatacgcgaggat
gggcaaaacctcatcgacatgtggctggagaaacggccgggtgcccgctatgtctggaac
aggacagagatgctggctgctgctgccaactccagagtgaattacttgatgggtctcttt
gaacctggggacatgaagtacagcctggtgcgtaacaccaccgtggacccatcactcact
gagatgatggaggcagccatcaccatcctgagcaggaaccccaacggcttctacctcttc
gtggaaggtggcagaatcgaccacggccaccacgatggtgcagcccataaggcgctgacg
gaggcggtggagtttgaccgggccatcgagcgggcaggcgccctgacagacgaggatgag
accctcactgtcgtcactgctgaccactcgcacgtcttctccttcgggggctacaccctg
cgtggctcctccatcttcggtctggcccccaagacagcccttgatgggaagaactacaca
tccatcctctacgggaatgggccgggataccaaggccctgacagacccgacgtggacgtg
gacacagccatggacttcgagtacctgccgcaggcagctgtgcccctcgactcagagacc
catggcggtgaggatgtggccatcctggccaaggggcccatggcccatctcttccacggg
gtgcaggagcagacctacgtggcccacgtcatggcctacgccgcctgcatcgagccctac
accaactgccgccagcgggacgctgcccctggcatccgtgccacccccctggccctgctc
ctgcctgccctccttctgcccctcttccactga

DBGET integrated database retrieval system