KEGG   Ficedula albicollis (collared flycatcher): 101816789Help
Entry
101816789         CDS       T02815                                 

Definition
(RefSeq) steroid 21-hydroxylase-like
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101816789
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     101816789
Cytochrome P450 [BR:fab00199]
 Cytochrome P450, animal type
  CYP21 family
   101816789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
22
AA seq 550 aa AA seqDB search
MTTGTTTLGQPPPDTFTSRILLGALRDPMLRRPPPGTPFYNAPPEDPHHGVSPLESPKTP
PAIHPKMGVPFLTSAPSDYCPNPPDAFPKIPRQDSPLGLGPPSPPKFWGPVQPLLFPAEV
LVPSSVGTIREALVRHWGDWLGRPSSYLGSLVSRGGRDLALGGPCPGWRQQRGAVRGALA
RAGGRLGPLLWLQGQELCEELRSHGEAPLDPSEVFTFHTCSTIARLLFGDLVPPPGELRA
FSRCLGELLQVWGRSSVQVLDLLPLLRALPNPGLRKLLQLVQHRDAFVEAQIQRHQACPS
PPVDTVLGALLGRNSGARGGPLSPPRLHMALVDLFIGGTETTAAALGWAVAFLLHRPETQ
HTCAPPVQLQARLRAELEGAQGPPGPGDMGRLPLLQATVSETLRLRPPAPLALPHCALRH
TSLGGLPVVAGTVLVPNLLAAQQDPDIWQHPEVFLPERFLAPGAPARSLLPFGCGARSCP
GEGLARAELFVFLGLILREFRVSAEREDPIYLLPVKFILLTPSCKSRVFLEPPKLRNLSP
VYMDFLSFPL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagggacaactaccctggggcagccccctcctgacaccttcacatcccgaatc
ttattgggagccctgagggatcccatgttgagacgtcccccacctgggacccccttctac
aatgcccctcccgaggacccccaccatggagtctcacctctggagtccccaaaaactccc
ccagcgatacatcccaagatgggggtccccttcctgacttcagctccctcagattattgc
cccaaccctcccgatgctttccccaaaatcccacgccaggattccccacttggtttggga
ccaccctcccccccgaagttttggggtcccgtccagcccctcctctttcctgcagaagtg
ctggtgccgagctcagtggggaccatccgtgaggcgctcgtccggcactggggggactgg
ctggggcgtcccagcagttacctggggtcgctggtgtcacgggggggccgggacctggca
ctgggaggcccctgccccggctggcggcagcagcggggagcagtgcggggggcactggct
cgggctggggggcgtctcgggccccttctttggctgcagggccaggagttgtgtgaggag
ctgcgttcccatggggaggcccccctggacccctctgaggttttcaccttccatacctgc
agcaccatcgcacgcctcctctttggggatctggtgccccctccgggggagctccgggcc
ttctcccgctgcttgggggagctgctgcaggtttgggggcgcagcagtgtacaggtgctg
gacctgctgcccctgctgcgggccctgcccaacccgggattgcggaagctgctgcagctc
gtccagcaccgtgatgcctttgtggaggctcagatccagcggcaccaggcgtgcccctcc
cctcccgtggacacagttttgggggcgctgctggggcgtaattctggggcacgggggggc
cccctgagccccccccggctgcacatggcgctggtcgacttgttcattgggggcactgag
accacggcggctgctctgggctgggctgtggccttcttgctgcaccgccctgagacacag
cacacctgtgctccacctgtgcagctgcaggcgcggctgcgggcggagctggagggggca
cagggaccccctgggccaggggacatggggcgcctgccccttctccaggccactgtcagc
gagaccctgcggctgcggccccctgcgcccctggcgctgccccactgcgccctgcgccac
accagtcttggggggctccccgtggtggctggcactgttctggtccccaacctgctggca
gcccaacaggaccctgacatctggcagcacccggaggtcttcctgcctgagcggttcctg
gccccgggcgccccggcgcggtcgctgctgccgttcggctgcggggcgcgatcgtgcccg
ggggaggggctggcgcgggccgagctcttcgtgttcctggggctgatcctgcgggagttt
cgggtcagtgcagagcgggaggaccccatttatctcctcccagtaaaatttatacttttg
accccatcctgcaagtcgcgggtcttcctggaacccccaaaacttcggaacctcagcccg
gtgtacatggattttctttcttttcctctttaa

DBGET integrated database retrieval system