KEGG   Ficedula albicollis (collared flycatcher): 101817057Help
Entry
101817057         CDS       T02815                                 

Gene name
UGT1A1
Definition
UDP glucuronosyltransferase 1 family, polypeptide A1
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101817057 (UGT1A1)
   00053 Ascorbate and aldarate metabolism
    101817057 (UGT1A1)
   00500 Starch and sucrose metabolism
    101817057 (UGT1A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101817057 (UGT1A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101817057 (UGT1A1)
   00860 Porphyrin and chlorophyll metabolism
    101817057 (UGT1A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101817057 (UGT1A1)
   00982 Drug metabolism - cytochrome P450
    101817057 (UGT1A1)
   00983 Drug metabolism - other enzymes
    101817057 (UGT1A1)
Enzymes [BR:fab01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101817057 (UGT1A1)
Glycosyltransferases [BR:fab01003]
 Others
  Hydrophobic molecule
   101817057 (UGT1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 529 aa AA seqDB search
MAPGLSASPPLVVLLLSLLGLAAAGKLLVVPVDGSHWLSMREVVDMLHQKGHEVVVVAPE
VSMHIKPSKSFVMKTYPVPFTKEELDEVVQGLIKDVFEEGSFLERVIRLYQRAKQNSALF
LATCTHLIHNKELIRYLEETKFDAVFTDPFLPCGAILAEYLSLPSVYFLQQVPCGLEFQA
TQCPNPPSYVPRVFTDLTDHMTFLQRVKNLLYEIPNFFLCDVVFQPYAELASEFLKREVT
VPDLLRQASIWLMKLDFVLHFPKPLMPNMVLISGVNCAYKKLNQEFEAIVNASGEHGIVV
FSLGSMVSEIPVKKAMEIAEALGTVPQTVLWRYTGKTPSNLPKNVKLVKWLPQNDLLAHP
KTRAFITHGGSHGVYEGICNAVPMVLMPLFGDQMDNAKRVESRGAGLTLNILEMTTSDIS
NALKAVINDKKYKENIQRLSDLHLDRPIHPLDLAVHWVEFVMRHKGAPHLRPAAHDLNWV
QYHSLDVIAFLAAVVLLSLFIAFKCCLCCCRRCFCKKGRTGRPAKAKSH
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggccccagggctcagtgcttctccaccacttgtggtcctgctcctgtccctgctgggt
ctggctgctgctgggaagctcctggtggtgccagtggacgggagccactggctcagcatg
cgggaggtggtggacatgctccatcagaagggacacgaggtggttgtggtggcacctgaa
gtctctatgcacatcaagccatccaagagctttgtgatgaaaacatatccagtgcctttc
acaaaggaagagctggatgaagttgtccaaggattaataaaggatgtatttgaagaagga
tcttttctagaacgagttattagactttatcaacgggcaaaacaaaactctgctctgttc
ctggctacctgcacccacttaatccacaacaaggagctcatcaggtacctcgaggagacc
aagtttgatgctgtcttcacagaccctttcctaccctgtggggcaatcctggcagagtat
ctttccctgccttccgtgtatttcctgcagcaagttccctgtggtttggaattccaggcc
acccagtgccctaaccccccttcctatgtccccagagtatttacagaccttacagaccac
atgacctttctccagcgggtgaagaacctgctctatgaaatccccaattttttcctctgc
gatgttgtcttccaaccttatgcagaactggcttcagaattcctcaagcgggaggtgacc
gtgcccgatctcctgcgccaggcttccatttggctcatgaagctggactttgtcttgcac
ttcccaaaacccttgatgcccaacatggttttgattagcggtgtaaattgtgcttacaag
aagctaaatcaggaatttgaagccattgtgaacgcctctggagaacatggcattgttgtc
ttctcgctgggctccatggtgtccgagattcctgtgaagaaagccatggaaatcgcagag
gccttgggaacagtccctcagacggtcttgtggcgctacacaggcaagacaccctccaac
ctgcccaagaacgtgaagctcgtcaaatggctgcctcagaacgacctcctggcccacccc
aagactcgtgcctttatcacccacggaggctcccatggtgtttatgagggaatatgcaat
gcagtgcccatggtgctgatgcctctgtttggggaccagatggacaatgccaagcgagtg
gagtcccggggagcagggctgaccctgaacatcctggagatgactaccagcgacatttcc
aacgccctgaaagcagtgatcaacgacaaaaagtacaaggagaacatccagcgcctctct
gacctgcacctggacagacccatccaccctctggacctggctgtgcactgggtggagttt
gtgatgaggcacaagggggcccctcacctgcgccccgctgcccacgacctcaactgggtg
cagtaccactctctggacgtcatcgccttcctggcggccgtggtgctgctctccctcttc
atcgccttcaagtgctgcctctgctgctgccgccgctgcttctgcaagaagggcaggacg
ggcaggcccgccaaggccaagtcccactag

DBGET integrated database retrieval system