KEGG   Ficedula albicollis (collared flycatcher): 101818070Help
Entry
101818070         CDS       T02815                                 

Gene name
EEF2K
Definition
eukaryotic elongation factor-2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
fab  Ficedula albicollis (collared flycatcher)
Brite
Enzymes [BR:fab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     101818070 (EEF2K)
Protein kinases [BR:fab01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   101818070 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 736 aa AA seqDB search
MADEDLIFRMEGIDNARTTPADSGNYLDADSDDEDNYFICPITDDPVSNKSANTKVDNYY
SNLAKTEQYSSSSSPRSFSFKNDTQHRSKHGSVVDHGRETWKHAIEKAKQMPDPWAEFHL
EDVETEHATRYRYNAVTGDWVEDEVLIKMASQPFGRGAMRECFRTKKLSNFLHTQNWKGA
YNYVAKQYIESVSRDVYFEDVRLQMEAKLWGEEYNRHKPPKQVDIVQTCIIEMKNRPGKP
LFHLEHYIEGKYIKYNSNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTD
PQIHTESGTDFGDGNLGVRGMALFFHSHFCNNICKSMGLAPFDLSSKEKDALDYNKKLLE
SAQTILRGTEEKCGSSRARTVSGSRPPLLSRLSETSGDEIMSDVAFDSLPCSPSSATPHS
HKVDMLNWPVFSEVDNLDQLDNKRDFENGGDSGYPSEKRSETEDLDHRERGHSNSSRRQE
SDEDSLGSSARISVEKWNLYNSARVHIHRPSCVAQEIQRLNALELEKKIGKSILGKVHLA
MVRYHEAGRFCEKDEEWDQESALFHLEQAADCGELEAIVGLGLMCSQLPHHILSEVTLED
TKENRNKGFNYLLRAAEAGDRPSMILVARAYDTGVNLGADRSQDWKEALHWYNAALNMTD
YDEGGEYDGTQDEPRYLLLAREAEMLMMGGFNLEKDPQRSGELYTEAAEAAMEAMKGRLA
NQYYQKAEEAWAMMEE
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaggaccttatttttcgtatggaagggattgataatgccagaaccactcca
gcagactccgggaattatcttgatgctgatagtgatgatgaagacaattattttatctgt
ccaataactgatgatccagtttctaacaagtctgccaataccaaagtagacaattattac
agcaatttagcaaaaactgagcagtacagctcaagctcttctcccaggagctttagcttt
aagaatgacacacaacatcgttctaagcatggctctgtggttgaccatggtcgggaaacc
tggaaacatgctattgagaaagccaagcagatgcctgatccctgggcagaatttcatctg
gaggacgttgagacggaacacgccactcgctacaggtacaatgcagttactggggactgg
gttgaagatgaagtccttatcaagatggcttctcaaccttttggccgtggtgcaatgcga
gagtgtttcagaacaaaaaagctgtccaacttcttacacactcagaactggaaaggtgcc
tataattatgttgccaagcagtacatagagagtgtaagcagggatgtttattttgaggat
gttcgactgcagatggaagcaaaactctggggagaagagtacaaccggcacaagccacca
aaacaggtggatatagtgcagacctgtattattgaaatgaagaacaggcctggaaagcct
ctctttcatctggaacattacattgagggcaaatacatcaaatacaactcaaattctgga
tttgtgcgagacgacaacattcgtctaactcctcaagccttcagtcacttcacctttgag
cgctcaggacaccagctcattgttgttgatatccagggagttggagatctttacacagat
cctcagatccatacagagagtggtacagattttggagatggcaacctaggtgttcgagga
atggccttgttctttcattctcatttctgcaacaacatctgcaaaagcatggggcttgca
ccatttgatctttcatccaaagagaaagatgccttggattacaataaaaagttgcttgaa
tctgctcagacaattctccgtggcacggaggagaagtgcggcagcagccgcgccaggacg
gtgtcggggagtcggcccccgctgctctcccgcctgtctgagacctcaggggatgaaatc
atgagtgatgtggcctttgactccctgccctgctctccatcctctgcaacccctcacagc
cacaaggtggacatgcttaattggcctgtgttcagtgaagtagataacttggatcagctt
gacaacaaaagggattttgaaaatggtggagacagtggatatccgagtgaaaagagaagt
gagacagaagatctggatcatagagagaggggccattcaaacagcagccggaggcaggag
tctgatgaagacagtttgggaagctctgcaaggatcagtgtggagaaatggaatctttac
aactctgccagagttcacatccacagaccatcctgtgttgcccaagaaattcagaggctc
aatgcactagaacttgaaaagaaaattgggaagtcaatccttggaaaggttcacctggcc
atggttcgctatcatgaagccgggcgcttctgtgagaaggacgaggaatgggatcaggaa
tcagccctgttccacctggagcaggctgcagactgcggggagctggaagccatcgtgggc
ttgggcctcatgtgctctcagctgccacatcacatcctttccgaggtcactcttgaggat
acaaaggagaacagaaataaaggatttaattacttgctgagagcagcagaagctggagac
cggccttccatgattctggtagcaagagcatatgatacaggtgtaaatcttggtgcagac
agatcccaggattggaaggaggcactgcactggtacaacgctgcactgaacatgacagac
tatgatgagggaggtgaatatgatggcacccaggatgagccccggtacctgcttctggcc
agggaggcagagatgttaatgatgggagggttcaacctggagaaggatccacagagatca
ggtgagctttacacagaagcagcagaagcagccatggaggccatgaagggcagactggca
aatcagtactaccaaaaagcagaagaggcttgggcaatgatggaagaatga

DBGET integrated database retrieval system