KEGG   Ficedula albicollis (collared flycatcher): 101818529Help
Entry
101818529         CDS       T02815                                 

Gene name
GPT2
Definition
(RefSeq) glutamic--pyruvic transaminase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00220  Arginine biosynthesis
fab00250  Alanine, aspartate and glutamate metabolism
fab01100  Metabolic pathways
fab01200  Carbon metabolism
fab01210  2-Oxocarboxylic acid metabolism
fab01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101818529 (GPT2)
   00220 Arginine biosynthesis
    101818529 (GPT2)
Enzymes [BR:fab01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101818529 (GPT2)
Amino acid related enzymes [BR:fab01007]
 Aminotransferase (transaminase)
  Class I
   101818529 (GPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101818529
NCBI-ProteinID: XP_005052721
Position
11
AA seq 549 aa AA seqDB search
MHRFVLVARQAAARLCGPGGCRGGRTDMALRCAASLAAGRQPRGPRREGTVRWSSAAKAS
AVKINEKASREKILTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKAN
IGDAHAMGQRPITFLRQVVALCTYPNLLDSPSFPEDAKKRARRILQGCGGNSLGSYTASQ
GINCIREDVASYIERRDGGVPADPDNIYLTTGASDGISAILKILISGGGKSRTGVMIPIP
QYPLYSAAISELGAIQVNYYLDEENCWALNVNELRRALNEAKAYCNPKVLCIINPGNPTG
QVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSEGCQFHSFKKILYEMGPEYYNNVELA
SFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVP
GEESYAQFIKEKESVLNNLAKKAKLTEDMFNKIPGVHCNPLQGAMYAFPRIFIPSKAIEE
AKAHKMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRITILPPVEKLKILLEKVKDF
HIKFLEKYA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgcaccggtttgtgctggttgccaggcaagctgcggcgcggctgtgcgggccggggggc
tgccggggcggaaggacggacatggctctgcgctgcgccgcttcgctggcggccggccgg
cagccgcggggaccccgccgcgaggggacggtgcgctggagcagcgctgccaaggcctcc
gccgtcaagatcaacgagaaggcgagcagggagaagatcctgacgctggagtccatgaac
ccgcaagtgaaggcggtggaatacgcggtgcgcggccccatcgttctgaaagccggggag
atcgagaaggagctgcggaagggaatcaaaaaaccttttactgaagtgattaaagccaac
attggagatgcacatgcaatgggacagagaccaatcaccttcctccgtcaggtggtggcc
ctgtgtacatacccaaacctgttggacagccccagctttccagaagatgccaaaaagcgt
gccaggcgaatcttgcagggctgtggaggaaacagcttaggatcctacactgccagtcaa
ggtataaattgcatccgtgaagatgttgcttcatacattgaaagaagagatggaggggtt
cctgcagatccagataacatttacctcaccactggggcaagcgacggcatttctgcaatt
ttaaagatcctgatctcaggaggtggcaaatcccgaacaggagtgatgattcctataccc
cagtatcccttatactcagcagccatctctgaactgggtgctatccaggtgaactactat
ttggatgaagaaaattgctgggctctaaatgtgaacgaacttcgccgtgccttgaatgaa
gctaaggcatactgcaatccaaaagtcctctgcatcatcaaccctggaaatcccacagga
caggtgcagagcagaaagtgcattgaagatgtgatacactttgcttgggaagagaagctt
tttcttctggctgatgaggtttaccaggacaatgtgtactctgaaggatgccagtttcat
tctttcaaaaagattctgtatgagatgggacccgagtactataacaatgttgagctggcc
tcttttcactccacctctaagggatacatgggcgaatgtggctacagaggaggttacatg
gaggtcatcaacttgcacccagaaattaaaggacagctcgttaagctgctttctgttcgc
ctttgtcctccagtctcaggacaagcagccatggatattgtggtgaatcctccagtacct
ggagaagaatcttatgcacagttcataaaggaaaaggaatctgttttgaacaatcttgcc
aaaaaagcgaaactaacagaagacatgtttaacaagatcccaggagttcactgcaacccc
cttcaaggagctatgtacgctttcccacggatctttattccttccaaagccattgaggag
gcaaaggctcataaaatggcacctgatatgttctattgcatgaaacttctggaagagact
ggaatatgtgttgtacctggaagtggatttggacagagagaaggaacctaccatttcaga
atcaccattcttcctccagtagagaagctgaagatcctactggagaaagtgaaagacttc
cacataaagtttcttgaaaaatatgcatga

DBGET integrated database retrieval system