KEGG   Ficedula albicollis (collared flycatcher): 101818529Help
Entry
101818529         CDS       T02815                                 

Gene name
GPT2
Definition
glutamic pyruvate transaminase (alanine aminotransferase) 2
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:fab01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:fab01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:fab01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:fab00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 549 aa AA seqDB search
MHRFVLVARQAAARLCGPGGCRGGRTDMALRCAASLAAGRQPRGPRREGTVRWSSAAKAS
AVKINEKASREKILTLESMNPQVKAVEYAVRGPIVLKAGEIEKELRKGIKKPFTEVIKAN
IGDAHAMGQRPITFLRQVVALCTYPNLLDSPSFPEDAKKRARRILQGCGGNSLGSYTASQ
GINCIREDVASYIERRDGGVPADPDNIYLTTGASDGISAILKILISGGGKSRTGVMIPIP
QYPLYSAAISELGAIQVNYYLDEENCWALNVNELRRALNEAKAYCNPKVLCIINPGNPTG
QVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSEGCQFHSFKKILYEMGPEYYNNVELA
SFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVP
GEESYAQFIKEKESVLNNLAKKAKLTEDMFNKIPGVHCNPLQGAMYAFPRIFIPSKAIEE
AKAHKMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRITILPPVEKLKILLEKVKDF
HIKFLEKYA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgcaccggtttgtgctggttgccaggcaagctgcggcgcggctgtgcgggccggggggc
tgccggggcggaaggacggacatggctctgcgctgcgccgcttcgctggcggccggccgg
cagccgcggggaccccgccgcgaggggacggtgcgctggagcagcgctgccaaggcctcc
gccgtcaagatcaacgagaaggcgagcagggagaagatcctgacgctggagtccatgaac
ccgcaagtgaaggcggtggaatacgcggtgcgcggccccatcgttctgaaagccggggag
atcgagaaggagctgcggaagggaatcaaaaaaccttttactgaagtgattaaagccaac
attggagatgcacatgcaatgggacagagaccaatcaccttcctccgtcaggtggtggcc
ctgtgtacatacccaaacctgttggacagccccagctttccagaagatgccaaaaagcgt
gccaggcgaatcttgcagggctgtggaggaaacagcttaggatcctacactgccagtcaa
ggtataaattgcatccgtgaagatgttgcttcatacattgaaagaagagatggaggggtt
cctgcagatccagataacatttacctcaccactggggcaagcgacggcatttctgcaatt
ttaaagatcctgatctcaggaggtggcaaatcccgaacaggagtgatgattcctataccc
cagtatcccttatactcagcagccatctctgaactgggtgctatccaggtgaactactat
ttggatgaagaaaattgctgggctctaaatgtgaacgaacttcgccgtgccttgaatgaa
gctaaggcatactgcaatccaaaagtcctctgcatcatcaaccctggaaatcccacagga
caggtgcagagcagaaagtgcattgaagatgtgatacactttgcttgggaagagaagctt
tttcttctggctgatgaggtttaccaggacaatgtgtactctgaaggatgccagtttcat
tctttcaaaaagattctgtatgagatgggacccgagtactataacaatgttgagctggcc
tcttttcactccacctctaagggatacatgggcgaatgtggctacagaggaggttacatg
gaggtcatcaacttgcacccagaaattaaaggacagctcgttaagctgctttctgttcgc
ctttgtcctccagtctcaggacaagcagccatggatattgtggtgaatcctccagtacct
ggagaagaatcttatgcacagttcataaaggaaaaggaatctgttttgaacaatcttgcc
aaaaaagcgaaactaacagaagacatgtttaacaagatcccaggagttcactgcaacccc
cttcaaggagctatgtacgctttcccacggatctttattccttccaaagccattgaggag
gcaaaggctcataaaatggcacctgatatgttctattgcatgaaacttctggaagagact
ggaatatgtgttgtacctggaagtggatttggacagagagaaggaacctaccatttcaga
atcaccattcttcctccagtagagaagctgaagatcctactggagaaagtgaaagacttc
cacataaagtttcttgaaaaatatgcatga

DBGET integrated database retrieval system