KEGG   Ficedula albicollis (collared flycatcher): 101818606Help
Entry
101818606         CDS       T02815                                 

Definition
fatty acyl-CoA hydrolase precursor, medium chain-like
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Drug metabolism - other enzymes
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:fab00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 563 aa AA seqDB search
MSRLSPIAVLCALLCKAAFLLCGTEGQSGAEPEVTIALGRLKGTQTNVKGTDKLVNVFLG
IPFAKAPLGPLRFSPPEPPEPWTGVRDATSHPPLCPQDLSMLKTAEKNFKEKHIAFQTSE
DCLYLSVYSPAGSSKKDKLPVMVWIHGGNFVFGGTARYDGSALSAYENVVVVIIQYRLGL
LGYFNTGDEHARGNWAYLDQVAALRWVQGNIEHFGGDPASVTLFGISAGSCSVFAHVLSP
LSKGLFHKAISESGIIIPPGKDLHLSTDLEKIANIFKCEASSSLSLLNCLRKQEAEHIIH
KSKEISFLPLVLDGVFLNKPPEEILAAKEFNAVPYMIGVTNNEFGWNIRSTSKMKSLREI
GDRKSIASTVEVFLPMIDVPSDFLPMILDEYLGDTEDPAELRDGFLDLLGDMAIVMPAIK
ALNYHRESGAPTYFFEYQHRASAFRDSKPDYVKADHGDEVGFVFGGPFLAGDIQLRSEVT
EEEKNLSRTLMKYWANFARNGNPNGEGLVEWPSYNLNEEYLQINLQQKKDRKLKEKKVKF
WKKVILEKTNKKSTQNKKFKLEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggctgagcccgatcgcggtgctctgcgccttgctttgcaaagccgcgttcctg
ctgtgcgggacagaaggacagagtggtgctgagccagaggtgactattgcacttggacgg
ctcaaaggaacacagacaaatgtgaaggggacagacaagctcgtgaatgttttccttgga
attccttttgcaaaagcccctcttggacctttgaggttttccccacctgaaccacctgaa
ccctggactggtgtgagagatgcaacttctcacccaccactctgtcctcaagatctgtcc
atgttgaaaacagctgaaaaaaactttaaagaaaaacacatcgcattccaaacttctgag
gactgtttgtatctgagtgtctacagccctgctggctcaagcaagaaggacaagttacct
gtaatggtgtggatccatggaggcaattttgtatttggtggtactgctcggtatgatggc
tctgcactgtcagcctatgagaatgtcgtggtggtaataattcagtacagactgggactc
cttggatacttcaatactggtgacgagcacgcccgggggaactgggcatacttggatcag
gtcgcagctcttcggtgggtccaaggaaatattgaacactttggtggagacccagcatct
gtcactctctttgggatatctgcaggatcttgctctgtttttgcacatgtgttatctcct
ttatctaagggtctctttcataaagcaatatcagagagtggaattataatccctcccggt
aaagatttacatctttcaacagatcttgagaaaattgccaatatcttcaagtgtgaggcg
agcagttccctctccctgctgaactgcttgaggaagcaggaagcagagcacataatccat
aaaagcaaggaaatctcatttctacccttagttttggatggagtgtttcttaataagcca
cctgaagagatattggctgcaaaagaattcaatgcagtcccttacatgataggagtcacc
aacaatgaatttggctggaatattagatcgacatcaaaaatgaaaagtttgagggaaata
ggagatagaaaatcaattgcctcaactgtagaggtttttctaccaatgatcgacgtaccc
tcagattttctgcccatgatcttagacgaatatctgggagacacagaggaccctgcagag
ctccgggatggattcctggacctgctgggggacatggcaattgtcatgccagccattaaa
gctctgaattatcacagggagtctggagctcctacctacttctttgagtaccagcaccgg
gcaagtgcattcagagacagcaaaccagactatgtgaaggctgaccatggggatgaagtt
ggttttgtctttggggggccgtttctggccggggacatccagctccgcagtgaagttaca
gaggaagagaagaacctcagtagaactctaatgaagtactgggctaactttgctcgaaat
ggaaatcctaatggagagggtctggttgaatggccgtcttacaacctaaatgaagaatac
ttgcagataaatctacagcaaaagaaagacagaaagttgaaagaaaagaaagtaaaattc
tggaaaaaagtgatccttgaaaagacaaataagaaaagcacacaaaacaagaagtttaaa
ttagagttatag

DBGET integrated database retrieval system