KEGG   Ficedula albicollis (collared flycatcher): 101818718Help
Entry
101818718         CDS       T02815                                 

Gene name
KYNU
Definition
kynureninase
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fab00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    101818718 (KYNU)
Enzymes [BR:fab01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     101818718 (KYNU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 531 aa AA seqDB search
MQQGVFAQEFHHALPGTAADHRTTWFYCRGEKMSFLCKITFSTIALLDMKVKLNDLKMDP
SSPVLPSSILEQTALQLGCSPTDKKLAFHLDEKDELKHLRECFYIPKVKDLPPTDLALVN
GEESCVYFVGNSLGLQPRKVRTYLDEELDKWARTGVHGHFNGQRPWALADECILDPMAEL
VGAKRQEIALMNGLTVNLHLLMLSFFKPTSRRYKILLEARAFPSDHYAVESQLQLHGLDV
EKSMLLLQPRQGEETLRTEDILAVIEKEGDSIAVILFSGVQYYTGQLFDIPRITKAGQKK
GCLVGFDLAHAVGNVELHLHDWGVDFACWCSYKYLNSGAGGLAGAYIHEKHSKSIKPALI
GWWGHDFKTRFLMENKLQLSEGINGFRLSNPPILLVCALHASLEVFSQTTMKTLRRKSIL
LTGYLEYLIKHYYSEDKANPEKPFVRIITPSQIEERGCQLTLSFSLPIKYVFKELEKRGV
ACDMREPNALRVAPVPLYNSFRDVHRFIEILGSAITSSKQTANNTVLSGSY
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaggagtatttgctcaggagtttcatcatgccctcccaggaacggctgccgac
cacaggacaacatggttttactgtagaggagaaaagatgagttttctatgtaaaattact
tttagcaccatagcgcttcttgacatgaaggtgaaattgaatgacctgaaaatggatcca
tcttctcctgtgctcccatcaagcattttggaacaaactgccttgcagctcggatgcagt
cccacggacaaaaagcttgctttccacttggatgaaaaggatgagttaaagcatcttcgg
gaatgtttctatatccccaaagtcaaggatctgcctccaactgacctggccctggtgaac
ggagaggagagctgtgtgtacttcgttgggaattctcttgggctccagccaagaaaagtt
agaacttacctggatgaagaactggacaagtgggctcggacaggtgtccatggccatttc
aatggccagcgcccgtgggctttggcagatgagtgcatcctggacccgatggctgagctg
gttggggccaaaagacaagaaatagccctaatgaatgggctgactgttaacttgcacctt
ctgatgctatctttctttaagcctacttcaagacgctataaaattcttctagaagcaaga
gcctttccatctgaccattatgctgtggagtcccagctccaactgcatgggctggatgtg
gagaaaagcatgctcctgctgcagccacggcagggggaggagaccttgaggactgaagat
atcctggcagtaattgagaaggaaggggactccattgctgtcattctgttcagtggggtg
cagtactacacaggacagttgtttgacattcccagaataacaaaggctggccaaaaaaag
ggatgccttgtcggattcgacctggctcatgctgttgggaacgtagagcttcatttgcat
gactggggagtggattttgcctgctggtgctcctacaagtatttaaattctggagcaggc
ggccttgctggtgcctacattcatgaaaagcattccaagagtattaaaccagcgctaatc
ggctggtggggccatgacttcaaaacacgattcctcatggaaaacaaattacaactaagt
gaaggaattaatggattccggttatcaaatcctccaattttactggtctgtgctctgcat
gccagtttagaggtttttagtcagactacaatgaaaacattgaggaggaaatccattcta
ctcactggttacctggaatacctgataaagcattactacagtgaggataaagcaaatcca
gagaagccctttgtgaggataatcacaccatctcagattgaggagagaggatgccagctc
actctgtcattttcccttccaatcaaatatgtgtttaaagagctggagaagagaggagta
gcttgtgacatgcgagaaccaaacgctcttcgcgttgccccagttcctctctacaattct
ttccgtgatgtgcacagatttattgaaatcctgggatctgcaattacatcttcaaaacaa
acagcaaataatactgtgctatctggttcttattga

DBGET integrated database retrieval system